KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32479Help
Entry
Dmel_CG32479      CDS       T00030                                 

Definition
CG32479 gene product from transcript CG32479-RA
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG32479
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG32479
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:61D2-61D4
AA seq 797 aa AA seqDB search
MSWTNSAQHKKSTQSVSVTASPNSVNNGPGVGAAGKANYSHTTKTFTNQQHYQQQHYHTQ
NSYNNNSSGGGSSSNSSSSSSNNQPQVRNYGTMKMPSSPVAWTAPTPERKNSQQAAAAPA
AATASAAPVAITTVTTSTASITATPNQFQPETGSSSASPAVAAAQQQQPAAQQHAQAAQT
GAAAAPSKSHSNYASSKKHQSYEPVVLSSVVATSSSANPQPQLNLAPPAPPASQNSSDSS
QLSWASLFASNKPVAKVAPYEASKIAQQQPSHPVLQLAPPQPAQVAAAAPVAQLSSPPQN
LPLPTAHQQSQLPAPVPAPTAPLVTPGALSYSAASAQAVPAPSPASASVKPLKPEPPRPV
QQQLDEWTSKYAEYLTRHKTNLASISLRPRGLTNRSNYCYINSILQALLGCSPFYNLLRS
IPKQAAVLSEVKTPTVNAMMSFMTNFSSLPSGLRLRLNNLNKGSQSKGKDDFVGSDLQCD
MAFEPTEIYKLWNDSREEHVEGRQEDAEEFLGYVLNKLNDEMLEVIKLIDKPTPQQNGQE
PAEPEDGGDVWQMICNNRNKGSVTRQTDFGRTPVSDIFRGELRSRLQREGEHSTDVIQPF
FTLQLNIEKAASVKEALEILVGRDQLEGVTGSKTKQEVVAWQQMTLEKLPVVLILHLKYF
DYRSDGCTKILKKVDFPVELKIDAKILGSKKTSQKQRAYRLFAVVYHDGKEASKGHYITD
VFHTGYSSWLRYDDSSVKPVSEKHVLQPHTPRVPYLLYYRRSDTLPPQQQQTQQQNGGGS
GGVVGSSSSSSNAGDNK
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggaccaattcagctcagcacaaaaagtcgacgcagtcggtgtcggtcaccgct
tctcccaatagtgtaaacaatggacctggagtgggtgctgcgggcaaagccaactatagt
cacaccactaagacatttaccaatcagcagcattaccagcagcaacactatcacactcag
aacagctataacaacaacagcagcggcggaggaagcagtagcaacagcagttcgagcagc
agcaacaatcagccccaggtgcgcaactatggcaccatgaagatgccctcttcgccggtg
gcttggacagcgccaacaccggagcgcaaaaacagccaacaggcagcagcggcaccggca
gcagcaacagcgtctgcagctcccgtggcaatcacaacagtaactacctcaacggccagc
attacggctaccccaaatcaatttcaaccggagaccggcagcagtagtgcatcaccagcc
gtagctgccgcgcagcaacagcagcctgcagcacagcaacatgcgcaggccgcacaaaca
ggagcagcagcagctccaagcaagtcccacagcaactatgcttcttctaaaaagcatcag
agctatgagccagtagtgctgagctccgtggtggccaccagttcatcagccaatccgcag
ccgcagctaaatcttgccccacctgcgccaccagcctcgcagaacagcagcgacagttcg
cagctttcgtgggccagtttgtttgccagcaacaagcccgtggccaaggtggcgccctac
gaagccagcaaaattgcacagcagcagccatcccatccagtgcttcaattggctcctccg
cagccagctcaagtggcggctgccgccccagttgctcagctgtcgtcgcctcctcagaat
ttgcccctgcctacggctcaccaacagtcacagttaccagcacctgtgccggcgcccacg
gctccgctggtcactccaggagcgctctcctattcggctgcatccgctcaggcagttcct
gctcccagccccgcgtcggcatccgtcaagcccctcaagccggaaccaccgcgtcctgtg
cagcagcaactggatgagtggaccagcaagtacgctgagtacctgacgcgccacaagacc
aatttggcgtcgatcagcttgcgtccccgaggactgaccaacaggtcgaactattgctac
atcaactcgatcctgcaggcactgctcggctgctcgccgttctacaacctgctgcgctcc
attcccaagcaggcggctgtcctgagcgaggtcaaaacgcccactgtgaacgccatgatg
tcttttatgaccaacttttcatcgttgcccagcggtcttcgcctgcgtctgaacaacctt
aacaagggatcgcaaagcaagggcaaggacgattttgtgggctcagatttgcaatgcgac
atggcctttgaacccacagagatctacaagctgtggaacgacagtcgcgaggagcatgtc
gaaggtcgtcaagaggacgccgaagaattcttgggctacgttctaaacaagctgaacgac
gagatgctggaggtgattaagctaattgataagcccacaccccagcaaaatggtcaggaa
cccgcggaaccagaggatggaggcgatgtctggcagatgatttgcaacaatcgtaataag
ggcagcgtaacccgccagaccgacttcggacgcactcccgtaagcgatatcttccgagga
gaactgcgctcccggctgcagcgtgaaggagaacactccacggatgtgattcagcctttc
tttacgcttcaactgaatatcgaaaaagctgcatctgtgaaggaggcactggagatcctt
gtgggtcgcgatcagctggagggagtcacaggcagcaaaaccaaacaggaggtggtggcc
tggcagcagatgacgctggagaaactgcccgtcgttctgatattgcatttaaagtacttc
gactaccgctctgatgggtgcactaagattttgaagaaggtggatttccccgtggaacta
aagatcgatgccaaaatcctcggctcaaagaagacctcgcagaagcagcgcgcctatcgt
ctgtttgcggttgtctatcacgatggcaaggaggcgtcgaaggggcactacatcacggac
gttttccacacgggctacagcagctggctgcgctacgacgacagctcggtgaagccggtc
agcgagaagcatgtccttcagccgcacacgcctcgtgtgccttacctgctgtactaccgc
cgttcagacaccctgccaccgcaacagcagcaaacccagcagcagaatggcggaggatca
ggtggagtcgtgggcagcagctcatcatcatcgaatgccggggataacaagtga

DBGET integrated database retrieval system