KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32703Help
Entry
Dmel_CG32703      CDS       T00030                                 

Gene name
Erk7
Definition
Extracellularly regulated kinase 7 (EC:2.7.11.- 2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dmel_CG32703 (Erk7)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dmel_CG32703 (Erk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:8D3-8D4
AA seq 916 aa AA seqDB search
MANYQTAHAQERRIQELDQTVESIFDVRKRMGKGAYGIVWKATDRRTKNTVALKKVFDAF
RDETDAQRTYREVIFLRAFRCHPNIVRLVDIFKASNNLDFYLVFEFMESDLHNVIKRGNV
LKDVHKRFVMYQLINAIKFIHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIY
DDLEQDGMLTDYVATRWYRAPEILVASRNYTKGIDMWGLGCILGEMIRQKPLFQGTSTVN
QIEKIVTSLPNVTKLDIASIGPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALL
VLNPHNRLTAKEAIRHPYVSRFQYASAEMDLHMDVVPPLKDHVRYDVDQYRNSLYELIDR
ETSCSNRTVSNSTPSSNRDELPKPVRVTKQARTTSAKQPTTSPAERKKEPSSVEVTQSRK
NIKLLGSAHKAQSKEINHMESAITQVSIASAPPAAAPPAPAATAPAVPRKSGDKSVPKCQ
HNNAAVQRELAAVAAAAAVARRKKSSWQSQAQSQGKFHTEAKAHVQTAIQTQKDNIKDSP
PRMIQESQSLTEAKAPIPKNRYSNKMCQEKKYKKKHHSMSCITRDTFPSETEHRQQREER
AYQRQMKRELQLKESYRRRIEAESEPLKETTEQESKTIKVIEQKVCEHTEKKADESLSKD
QQKDSITFGTCVRERIHHLELEMEKCTEELVDFVELNADVLNYANVSTHLKKLQRSKESD
EKDEDDRRALPEGIGGPGSQNYEIFRQEQEKERQRQVQEFLARDETNEYDNLDLDHAYRA
KYYTAYKEIGKELNPAPDSGGRDSGSEHSPGRDNYTTYADYFLKYTTPQQNWNDLERANG
LQREHDRIYGLFWLNDRRQEEKYRRKLAQNDQEELPVHHHKACRHRHHKPNHHAPYDHMR
PTEDDIQEADSLPESN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggccaactatcaaactgcccacgctcaagagcgacgcattcaagagctggaccaaact
gtggaaagcattttcgatgtgcgaaagcgcatgggtaagggtgcctatggcatcgtctgg
aaggccactgacaggcgtacaaagaacacggtggccctgaagaaggtctttgatgccttc
cgcgacgaaaccgatgcccagcgcacctaccgtgaagttatattcctgcgggcctttcgc
tgccatcccaacatcgttcggctggtggatatctttaaggcctccaacaacttggacttt
tatttggtgttcgagttcatggagagcgatctgcacaatgtgatcaagcggggcaatgtc
ctcaaggacgttcacaagcgattcgttatgtatcagctgatcaatgcgattaagtttatt
cactcgggcaacgtcatccatagggacctgaaacccagcaacatcctgatcgacagcaaa
tgcaggctcaaagtggctgattttgggctggccagaaccctctcctcgagacgcatctat
gatgatttggaacaggacggcatgctgactgattatgttgccacgcgttggtatcgcgcc
cccgaaattctggtggccagtcgcaactacaccaagggaatcgatatgtggggcctgggc
tgcatcctgggcgagatgatcaggcagaagcccctattccaaggcactagcactgtcaat
cagattgagaagattgtgacttccctgccgaatgtgacaaagctggacatcgcttcgatt
ggacccagcttcggcagcgtcctgctgagcaggaatatccaacgcgatcgccgctattcg
ctggacgaaatgatgaagaactgctgcgacgacggtatttcgctggtgaaggccctgctg
gtgctgaatccgcataaccggctgacagccaaggaggccataaggcatccttatgtgagt
cgcttccagtacgcgtcggcggagatggatcttcacatggacgtcgtgccgccgctgaaa
gatcatgtgcgctacgacgtggaccagtatcgcaacagtctgtatgaactgattgaccgg
gagacgagttgcagtaaccgcacggtcagcaattccacgccatccagcaatcgggacgag
ttgccaaaacccgtgcgagtcacgaagcaagccaggacaacaagtgccaagcaaccgacc
acgagcccggcggaaaggaagaaggagccatcttccgtcgaggtgacccagtcgcgcaag
aacattaagctgctgggctctgcacataaggcacagtcgaaggagatcaaccacatggag
tctgcaattacgcaagtctctattgcttctgctcctcctgctgcagctcctcctgctcct
gctgctactgctcctgctgtaccgcggaaatctggtgataaatctgtccccaaatgccaa
cacaacaatgcggcggtccaacgggaattggctgccgtggcggccgcggcagccgtggct
cgccggaagaaaagcagctggcaatcgcaggcacagtctcaaggtaaattccataccgaa
gcgaaggcccatgttcaaactgcgattcagacccagaaggacaacatcaaagatagccct
ccgaggatgatacaagagtcccagagcctgacggaagctaaagcgcctattccaaagaat
cgctactcaaacaagatgtgccaagagaagaaatataaaaagaaacaccatagcatgtcc
tgcatcacaagggatacgtttccctcagaaacggagcatcgccagcagagggaggaaagg
gcgtaccagcgacagatgaaacgggagctccagctgaaggagagctaccgccgccgcatt
gaggcggagagcgaacccttgaaggagacaactgaacaggagtccaagacgatcaaggtg
atagaacaaaaggtgtgtgagcatactgaaaagaaggcggatgaatcgttgtccaaggat
cagcagaaggattcgatcacctttggcacatgcgtccgcgaacggatccatcacctggag
ctagagatggagaagtgcacggaggagttggtggactttgtcgagttgaatgcggatgtg
cttaactatgcgaacgttagcacccacttgaaaaagctgcagcggtcaaaggagagtgat
gagaaggatgaggatgacagaagagccctgccggagggcattggtggtcccggatcccaa
aactacgagatctttcgccaggagcaagaaaaggagcgccagcgccaggtgcaagagttc
ttggcccgcgacgagaccaatgagtacgataatctcgacctggaccacgcctacagagct
aagtactatacagcatataaggaaatagggaaagaactcaaccccgcaccggacagtggg
ggacgcgattccggatcggagcattccccggggcgggacaactacaccacgtatgccgac
tactttctcaaatacaccaccccacagcagaattggaatgatcttgagcgagcgaatgga
ctccagcgggagcacgaccgcatatacgggttgttttggctgaatgatcgcaggcaggag
gaaaaatatcgccgcaagttggcacagaatgaccaagaagaactcccagttcaccaccac
aaggcgtgccgccatcgccaccacaaacccaaccaccatgctccctacgatcacatgagg
cccacggaggacgacattcaggaggcggactccttgccggagagcaactga

DBGET integrated database retrieval system