KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32717Help
Entry
Dmel_CG32717      CDS       T00030                                 

Gene name
sdt
Definition
stardust (EC:2.7.4.8)
Orthology
K06091  
MAGUK p55 subfamily member 5
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dmel_CG32717 (sdt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
Position
X:7D17-7D22; X:1-23 cM
AA seq 2020 aa AA seqDB search
MQANSSRSNLSAQSSGTPSASTISSSQGKQQVVELSGYVIILVENVEGKIKLYGSPPDRD
NLEVGDEILEVNGLTLENISRTEVIRHIHDCIKSCTICLRVRKKNDSRLAWDIGNSVQDA
FVIAVEEHARERLQRLAALNRVTPVDITQLSKKLQQTKSGTATSQRQDLSFLNESTPIYV
TSFTSNQITCSSSTMTTATAGGPISAPSLATATTTVPTASSHTTTVVAQIEHGASALVSA
AVAAATAADRNANSTTSAALKQTANCIGNSTSSLGTTSTTSSQSTSSATGHIYQTSQAQQ
QQLQQLQQQLAAAAAAGKPLQAKSLLASSLQHLAEEVDNEDLDDDDDVDGANYCGITYIS
YNNKHAQLPTTTLPATTALPAAAASLATTAAIYQQRQQQQHQQQQQQQQQPVHHHNHPPT
ASQLNRATAPAPLQLGGPVNPSFVDAQTSTSPLMAQQLHSQHADVDAAPPSSSSSSAVVV
VERHVHGTTTPKTEYSTAISSGQLQQAFAELQLHSSNNNATQQQQQHLLLSNNNNSNNSM
AAAQTTASLMKNCDLLISNNLYPPRRELLEDVIVHQASDVHSYSTSASAAAIASSSNRSQ
QQQQQQQQHQLLSAAYELQQQQQLQLQQQQQQQNSPTSSISIGRTELLLGDQSLRQDPRG
NRRRSGSSIVVLDGDDLKPCLPDDYISGQHHLNHQQQLQLQQQLQQQHPLQQQHYRTHSG
DIREIDQEMLTMLSVNQDNGPHREMAVDCPDTFIARNKTPPRYPPPRPPQKHKKSTNTTT
TTTITALTNNDHANKMLIVAYHSSHQHEQLQQQHPSKTSTTTTTIALDVATQNLYNQKQQ
NKLEQIENYENCLQSERNEQHEQQFEQQKQHQATTAMAATQVAQQQTPSHKLQATLSSDP
NGNSNSNNNSHIVGISSSSSSNNSSITDDFLCVVDGLYQGRKDTASPSSSAFDEVMSKHT
LDSFGSIAYRHLHQQHQATSNGNSSSNTSNTNSNTNSNTNSNSNTNGNTSNNTAVSTKTA
TVTKTGVSSSNSNSNSLNSSNSSMHTSSSSSGHSSNIASATSSSSATSSSTVPDDLSLAP
PGYEVSQQQQQQHLVATPVTMLLPPMAKHRELPVDVPDSFIEMVKTTPRYPPPAHLSSRG
SLLSNGSASTAHTTLSSMGVAPSPVTATAAAAASASAACATTAVAAAAVSGVADGDARRV
ADELNGNAKPVPPPRDHLRVEKDGRLVNCSPAPQLPDRRAPGNASSGSSGATTHPLQHQQ
IAQIVEPTLEQLDSIKKYQEQLRRRREEEERIAQQNEFLRNSLRGSRKLKALQDTATPGK
AVAQQQQQATLATQVVGVENEAYLPDEDQPQAEQIDGYGELIAALTRLQNQLSKSGLSTL
AGRVSAAHSVLASASVAHVLAARTAVLQRRRSRVSGPLHHSSLGLQKDIVELLTQSNTAA
AIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTPTPTPAIGAATGSTLSSPVAGPKRNL
GMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLATMPMSMPVNLPMSACFGTLNDQND
NIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKT
VNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDY
DPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQSFQHQRE
TMKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYATTAPDETDP
EEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPHTSRARREG
EVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQS
LKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGHLFDM
IIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 6063 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcgaacagcagccgctccaacttaagcgcacaatcctcgggcacgccgtcggcc
tcaacgatctcctcgtcccagggcaagcaacaagttgtcgaactatcgggctatgtcatc
atactcgtcgaaaatgtggagggtaaaattaaactatacggctcaccgcccgatcgcgat
aatctggaagtgggcgatgagatactcgaggtcaatggcctgaccctggagaatatatcg
cgcacggaggtcattcggcacatacacgactgcatcaaatcctgcaccatttgtctgcgt
gtgcgaaagaagaatgattcacgactggcctgggacattggcaactcggtgcaggacgcc
ttcgtcatcgccgtcgaggagcacgcccgcgaacgtctgcagagattggcggccttgaac
cgggtcacgcccgtcgacatcacccagctgtccaagaagctgcagcaaacgaagagcggc
actgcgaccagtcagcgccaggatctcagcttcctgaacgaatcgacgccgatctatgtg
acatccttcacgagcaaccagatcacctgcagcagttccacaatgacgacggccaccgcc
ggcggtccgatcagtgcaccatcgctggcgacggccactaccaccgtgccgacggcatcc
tcccacaccaccacggtggtggcccagatcgagcacggtgcatcggcgctggtcagtgcc
gctgtggcagcagccactgcagcggatcgcaatgcgaatagcacaacgtcggcggcccta
aaacagacggccaattgcattgggaatagcacaagcagtcttggcacgaccagcaccacc
agcagccaatcgaccagcagtgccacgggccacatctaccagaccagtcaggcgcagcag
cagcagttgcaacagttgcagcagcagcttgcggcagcagcggcggctggaaagccattg
caggccaaatccctgctggccagcagcttgcaacatctggccgaggaggtggacaacgag
gatctggacgatgatgacgatgtggatggggcaaactattgtggcataacctatataagc
tacaacaacaaacatgcccagttgccgacgacaacattgccggcgacgaccgcattgcca
gcggcagctgcatcattggccacaacggcggcgatttaccaacagaggcagcagcaacaa
catcagcagcagcagcaacagcagcagcagccggtgcaccaccacaaccacccaccaacg
gcgagccaactgaatagagccacagcaccggcgccactgcagcttggaggtcctgtcaat
cccagtttcgtggatgcccagacatccacatcaccgctgatggcacagcagcttcattcg
cagcatgcggatgtggatgcagcgccaccatcgtcgtcatcatcatcagcggtggtggtg
gtggagcggcatgtgcatggcaccaccacgcccaaaacggagtactccacggccatatcc
agtggccaactgcaacaggcctttgccgaattgcagctccactcgagcaacaataatgca
acacagcagcagcagcaacatttacttttaagcaacaacaataatagcaataattcaatg
gcagcggcacagacaacggcatctctgatgaagaattgtgatctactgatatcgaacaat
ctgtatccaccgagaagagagttactagaagacgtcatagtccatcaagccagtgatgtg
cattcatacagcacgagtgcatcagcagcagcgatcgccagcagcagcaacagatcacag
caacagcaacagcagcagcagcagcatcagttgctgagtgccgcctacgagttgcagcaa
cagcagcaattgcaacttcagcagcagcagcagcaacagaacagtcccacaagtagcata
tcaattggaagaactgaacttttactgggcgatcagagtttgcggcaggatcccagaggg
aatcgccggcgctccggatcgagcattgttgtgctggatggcgacgatttgaagccatgt
ctgccggatgactacataagcggtcagcatcatttgaaccaccagcagcagctgcaactg
cagcagcagctgcagcagcaacatccgctccagcagcaacactatcgcacgcactcgggc
gacatcagggagattgaccaggaaatgttgaccatgttgtccgtgaaccaagataacggt
ccacaccgtgagatggccgtcgattgtccggacacgttcatcgcacgcaacaagacgcca
ccccgatatccgccaccccgtccaccacagaaacacaagaaaagcaccaacaccaccacc
accaccacaatcacagctttgactaacaatgatcatgctaacaaaatgttaattgttgca
tatcattcttcacatcaacatgaacaactacaacaacaacacccatcaaaaacatcaaca
acaacaacaacaattgcactcgatgtggccacacaaaatttgtacaatcaaaaacaacaa
aacaaattggaacaaatcgaaaactatgaaaattgcctgcaatcggaacgaaatgaacaa
cacgaacaacaatttgaacaacagaagcaacatcaagcgacaaccgcaatggcagcaaca
caggtggcacaacagcagacgcccagccacaagttgcaggcaacattgagcagcgatccg
aatggcaacagcaatagcaacaacaatagccacatagttggcatcagcagcagcagcagc
agcaacaacagcagcatcaccgatgatttcctgtgcgttgtggatggcctgtatcaggga
cgcaaggacacggcctcgccctcatcgagcgccttcgatgaggtgatgagcaaacatacc
ctggactcctttggcagcatcgcctatcgtcacctgcaccagcagcatcaggcgacgagc
aatggcaacagcagcagcaacacgagcaataccaacagcaacaccaacagcaacaccaac
agcaacagcaacaccaatggcaacacgagcaacaacacagctgtttcaaccaaaacggca
acggtgaccaaaacaggcgtgagcagcagcaacagcaacagcaactcgctgaacagcagc
aacagctcgatgcacacgagcagcagcagcagcggtcacagcagcaacatagccagtgcc
acatcatcatcatccgccaccagcagctcaacggtgcccgatgatctgagcctggcgcca
cccggctacgaggtgagccagcagcagcagcaacaacatttggttgcaacgcccgtgacc
atgttgctgccaccgatggccaagcatcgcgagctgcccgttgacgtaccggacagcttt
atcgagatggtcaagaccacgccaagatatccgccaccagctcatctctcctcacgcgga
tcgctattgtcgaacggcagcgcctccaccgcccacaccacgctctcctcgatgggcgtg
gcgccttcgcctgtcactgcaacagcagcagcagcagcatcagcatcagcagcatgtgca
accactgcggttgctgctgctgcggtttctggtgttgctgacggcgatgcgaggcgggtg
gccgatgagctcaatgggaatgcgaagcccgtaccgccgccacgtgatcatctgcgggtg
gagaaggatggtcggctggtcaattgctcacccgcaccacagctgccggatcgcagggcg
ccgggaaatgcgagcagcggcagcagcggcgccacaacgcatccgctgcagcatcagcag
atcgcccagattgttgagcccacattggagcagctggacagcatcaagaaataccaggag
caactgcgccgacgacgcgaggaggaggagcgcatagcgcagcaaaatgaattcctgcgg
aacagtcttcgtggctccaggaagctgaaggcgcttcaggatacggctacgcccggtaaa
gcggttgcccagcagcagcagcaggcaacgctggccacccaggtggttggcgtggagaat
gaggcatatctgcccgacgaagaccagccgcaggcggaacagatcgatggctatggcgaa
ctgatagcggcccttacccgcctgcaaaaccagctgagcaagagcggactgagcacgctg
gcgggtcgcgtttcggccgcccacagtgtcctggccagcgccagtgtggcccatgtcctg
gccgctcgcaccgcagtactgcagcgacgacgttcccgcgtctctggtccactgcatcac
agttccctcggattgcagaaggacattgtggagctgctaacgcaatcgaatacggcggcg
gccatcgagctgggcaacctgctgaccagccatgaaatggagggtctgctactggcccac
gatcgcattgccaatcacacggatggcacgccctcgccaacgcccacgcccactccggca
attggagcggcgacgggatcgacactcagcagtccggtggctggacccaagagaaatcta
ggtatggtggtgccaccgcccgtggtaccaccgccactggcgcaacgcggagcaatgcca
ctgcctcgcggggagtcgccaccgccggttcccatgccaccactggctacaatgcccatg
tccatgcccgttaatctgccgatgagtgcgtgctttggcacgctaaacgatcagaacgac
aacattcgtatcatccagatcgagaagtcaacggagccgctgggcgccacagtgcgcaac
gagggtgaggcggtggtcatcggtaggattgtgcgtggtggagcggcggagaagtcggga
ctgttgcacgaaggtgatgagatactggaggtcaacggtcaggagttgcgtggcaagacg
gtgaacgaagtgtgcgccctgttgggcgccatgcaaggcaccctgaccttcctgatcgtc
ccagcgggtagtccaccgtccgtcggcgtgatgggcggaacaacgggcagtcaactggcc
gggttgggtggagcacatcgtgacaccgccgtgttgcacgtacgggcgcatttcgactac
gatccagaggacgatctgtatataccctgccgggagctgggcatcagcttccagaagggc
gatgtactgcacgtgattagccgcgaggatcccaactggtggcaggcgtatcgcgagggc
gaggaggaccagacgctggccggtcttattcctagtcagtcgttccagcatcagcgcgag
accatgaagctggccattgcggaggaggcgggtctggcgcgatcccgcggtaaggacgga
tcgggcagcaaaggagccacgctcctgtgtgcgcgcaagggtcgcaaaaagaagaagaag
gccagctccgaggcgggatatcctttatacgccaccacggcgccggatgaaacggatccg
gaggagatactcacctacgaggaggtggccttgtactatccccgcgctacccacaagcgg
cccatcgtcctcatcggcccgcccaacattggaagacatgagttgcgccaacgtctgatg
gccgactcggagcgtttctccgccgcagtgccacacacatcacgagcccgcagggagggc
gaagtgcccggagtggactaccacttcatcacgcgacaggcctttgaggcggatattttg
gcgcgccgctttgtggagcacggtgaatatgagaaggcctactacggcacatcactggag
gccatacgcacggtggtggccagcggcaagatctgtgtgctcaacctgcatccgcagagc
cttaagctgctgcgcgcctctgacctcaagccgtacgtggtgctggtggcgccgcccagc
ttggacaagctgcgccaaaagaagctgcgcaacggcgaacccttcaaggaggaagagctc
aaagacatcattgccacggccagggatatggaggcccgttggggtcacctattcgacatg
atcataatcaacaacgacacggagcgcgcctaccaccaactgctggccgagatcaactcg
ctggaacgcgagccccaatgggtgcccgcccagtgggtgcacaacaatcgcgacgagtca
taa

DBGET integrated database retrieval system