KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32812Help
Entry
Dmel_CG32812      CDS       T00030                                 

Definition
CG32812 gene product from transcript CG32812-RA (EC:3.1.3.16)
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmel_CG32812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:1F1-1F1
AA seq 225 aa AA seqDB search
MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLN
PLHRQIIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFD
TRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCC
DHISYGEFEKRLFSVDVDRRLSIAKWLEDDDEADAEMVLPVGSGP
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggctcggtaggaagtcgtcagctcaaccccgtccaactgtgtgaccaccagcaggcc
acagggctgtccgcagagcagctagagcagctgcacacgcggttccgcagcctggatcgc
caccagcgcggctatttgacgcccaccgacttgctgcgcattccgcagctatccctcaac
ccgcttcaccgccagatcatcgacggcttcttccccagccgtgaccccagcgcgcgtatc
ggtttcaagcagttcgtggacacttgctccaccattttggtgccacagtttggacgcggt
tcagtgaggcggcgcgacgggcgtgttcagaagcttcaactcctgtccaagatgtttgac
acgaggcgcagcggctgcatcacacgctccgacttccgccagatcatgcgcagcattgtc
aatctggcctggagtcagcaacaggatcaggaacgtcaggaggggctttccgagaaccgt
ttgcctgaggtggaggccgagttgcaacttttagagcatcaggcctttggcttctgctgc
gaccatatctcatatggggagttcgagaagcgcctgtttagtgtggacgtcgacagacgg
ctgtcgatcgccaagtggctggaggacgatgacgaggccgatgccgagatggtactgcca
gttggctcaggcccgtaa

DBGET integrated database retrieval system