KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32849Help
Entry
Dmel_CG32849      CDS       T00030                                 

Gene name
Hex-t2
Definition
CG32849 gene product from transcript CG32849-RA (EC:2.7.1.1 2.7.1.2 2.7.1.4 2.7.1.7)
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dmel_CG32849 (Hex-t2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG32849 (Hex-t2)
   00051 Fructose and mannose metabolism
    Dmel_CG32849 (Hex-t2)
   00052 Galactose metabolism
    Dmel_CG32849 (Hex-t2)
   00500 Starch and sucrose metabolism
    Dmel_CG32849 (Hex-t2)
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG32849 (Hex-t2)
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    Dmel_CG32849 (Hex-t2)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dmel_CG32849 (Hex-t2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:97B3-97B3
AA seq 486 aa AA seqDB search
MRKSTRLLTHSLFGPVFKILFHNKTVCGGCNRKMPSLVNTEIEAAVKGFLIDQEKMTEVV
ERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLISN
SDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQG
LSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHP
NCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPSMIINCEWGAFGDNGVLEFVRTSYD
KAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAY
ISDVESDAPGEYRNCNKVLSELGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINK
MNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAATAV
QAKSKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaactagacttttaactcattctctattcggccctgtatttaaaattttg
tttcataacaaaacagtttgtggaggctgtaataggaaaatgccgagcctggtgaacacg
gaaattgaagccgcggtcaagggcttcctgatcgaccaggagaagatgaccgaggtggtg
gagcgcatgaccaaggagataaagatgggcctggccaaggacacgcatgcacgagcggtg
atcaagtgcttcgtcagccatgtgcaagatctgcccactggcaaggagcggggaaagtat
ttggccctggatctgggtggctctaatttcagggtgcttctggtgaacctgattagcaac
tcggacgtggaaaccatgtcgaagggctataattttcctcaaactctgatgtccggatcg
ggaaaggcgcttttcgacttccttgccgaatgcctgtcggagttttgtcactcccatggc
ctggagaatgaatcactggctctgggcttcaccttctcgtttccgctccagcagcaggga
ctctccaagggtatccttgtggcctggaccaaaggattcagctgcgaaggcgtggtgggc
aagaatgtggtgagtcttctccaggaggcaatcgatcgaaggggcgatctaaagatcaat
accgtcgccattctcaacgatacggtgggcactctgatgtcctgcgccttctatcatccc
aactgccggattggattgatcgtgggaaccggctccaatgcgtgctatgtggagaaaaca
gtaaatgccgaatgcttcgaaggataccagaccagtcccaagccatcaatgataatcaac
tgcgagtggggcgcctttggggacaatggtgttctggagttcgttcgaacttcctacgac
aaggcagtcgacaaggtaacacccaatcccggcaagcagacgttcgaaaagtgcatatcg
ggcatgtatatgggtgaacttgtacgtttggtcatcaccgatatgattgccaagggtttt
atgttccacggcatcatttccgagaagatccaggagcgatggagcttcaaaaccgcctat
atttccgatgttgaaagtgatgcacctggcgagtatcgcaattgcaataaggtccttagc
gaattgggcatattgggctgccaggaacccgacaaagaggccctgcgatacatctgcgag
gcggtgtcctccaggtctgccaagctatgtgcctgcggcctggtcaccattatcaacaag
atgaacatcaacgaggtggccatcggcatagacggtagcgtgtatcgcttccatcccaag
taccacgacatgctccagtaccacatgaagaagctcctcaagccgggcgtcaagtttgag
ctggttgtttcggaggacggatccggaagaggagcggctctcgtggcggccaccgcagtc
caggccaaaagcaagctctaa

DBGET integrated database retrieval system