KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33090Help
Entry
Dmel_CG33090      CDS       T00030                                 

Definition
CG33090 gene product from transcript CG33090-RE (EC:3.2.1.21 3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dmel_CG33090
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dmel_CG33090
Enzymes [BR:dme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dmel_CG33090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:35A4-35A4
AA seq 948 aa AA seqDB search
MAEPLAVETKPLSNGNANGNAVGIAESASAVFQEKLKLQQQEESNEIAAVPKYGLKLKFD
HVWPEKRIQNVRASIRQTLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPI
GGIGGGTIGRGYAGEFCRFQMRPGIYEYNVVLANQFIVTIKDPKGCTIFQSLLSKCSTRD
KTSDPDGDPDGERTKCQLPNCSSRAKQPLSAWHSNIEDTRCSYTGLYPRSWTEYDLSHYG
VRLTCRQVSPVIPHEYRESSLPCAVFVWSVENVCDQERKVSITFTFKNGTGNKKQDAEGG
AESQLISEGNAKGVSIRQKISEMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKE
HGQLSEHPTSEALKTKDIGVAVCGQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYY
TKYFDDSGDSGPRICEYALRQYSTWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDG
GTIWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQV
SLQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVND
WKDLNTKFVLQVYRDYYVLNELAQAQSDNASKFSSIEFIDKESLYELYSQDNKRKNSADE
KQQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAIMERTIEYDKDNDGLIENTKMPD
QTYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNG
SYYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGN
IGAANGFIANASEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYK
TLSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacctttagcagtggaaaccaagccgctgagcaacggaaatgccaatggaaac
gcagtgggaatcgccgaatccgccagcgctgtcttccaggagaagttgaagctccagcag
caggaggagtccaacgagatcgcggcagtgccgaagtacggactcaagctgaagttcgac
catgtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgccc
atggtgccactcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgt
cgggtgtacatggactactactacatggagaatggcaagcagatctatggagtgcccatc
ggcggaattggaggtggtacgattggcaggggctatgccggcgagttctgccgtttccag
atgcgtcccggcatctacgagtacaatgtggtgctggccaatcagtttatcgttaccatc
aaggatcccaaaggatgcaccatctttcagagcctcctctcgaagtgcagcaccagggac
aagaccagcgatccggatggcgatccggatggggaaagaactaaatgtcaactgcccaat
tgcagcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggacacgcgc
tgcagctacacgggtctctatcctcgctcctggacggagtacgatctgtcccactatgga
gtccgtctgacctgtcgccaggtatcgccggtaataccgcatgagtaccgcgagtccagc
ctaccgtgcgccgtcttcgtgtggagcgtggagaatgtttgcgaccaggagcgcaaggtg
tccatcacgttcactttcaagaacggcacagggaacaagaaacaggatgcggagggcgga
gccgagtcgcagctaatcagcgagggcaacgccaagggagtctccatcaggcagaagatc
tctgagatgccctgcagttataatctggcatgtagggtccttcccgagatcagcatcacg
cggtgcccccagttcgatccggccggcaacggtgagcagttgtgggcacagctcaaggag
catggccagcttagcgagcatcccacctcagaggcactaaaaaccaaagatataggcgtg
gctgtctgtggccaggtggccctgaagccaatggcatcccacgatctggagtttgtgctg
gcctgggatatgccaaagattcagttccccaggaagatgcagacccatacacgctactac
accaagtacttcgatgacagcggtgattccggtcccaggatctgcgagtatgcactcagg
cagtattccacctgggagcgattgattgatgcgtggcaaagacccattctcaatgatgaa
acccttcccgactggtacaagtgtgccatcttcaatcaactttacttcatctcggatggc
ggaaccatttggttgaaatgtgattcttcgctgggcaaggaactggcttatgatgatccc
cgactggcttatggccgtttcggttacctggaaggccacgaataccgcatgtacaacacc
tacgatgtccatttctatgcatcgccggctctggcccacctgtggcccaatcttcaggtc
agtctgcagtatgacttcaaggatgccattgccgcagaactaaacgatactcgtaaaatg
ctttacgatggcaaggtgatgccgcgcaaggtcaagaactgtgtgccccacgatctcggg
gatcccgatgaggaacccttcaccttgatcaactgctacaacatacacgatgtgaatgac
tggaaggatctcaatacgaagtttgtgctgcaggtgtatcgggactactatgtcctcaat
gaactggcccaggcccagtcggataatgcaagcaagttcagctccatcgagtttatcgat
aaggagagcctttatgagctgtacagccaggacaacaagcgcaagaattcagctgatgaa
aagcaacaaaaccgtaaatctgcatcgatgtacatcaacgaaaccaatggaaaggtgtat
ctaatggatgccattggctacttgaaggccatgtacgcatcgtgcaaggccattatggag
cgaaccattgagtacgataaggacaacgacggtctgatcgagaacacaaagatgccggac
cagacctatgactcctgggtgatggacggaccgagtgcctactgctccggtctctggctg
gctgctctgcaagccatgtccgccatggctaccattctggaccagccgaacgattgcctg
cgctatcaggatattttggagaagggcaagcgatcgctggaggagaagctctggaatggc
agttactatcgctttgatctttcgcacagtcatcgggatacgatcatggccgatcagtta
tgtggtcattggtatctaaagtcctgcggcttcgattacgagatctatccgaaggagaat
gtgcgtactgcccttaagaggatctatgacaacaatgtgatgggctttcatgagggcaat
atcggagcggccaatggcttcatagccaatgccagcgaacccaccaagccgggtcacgtg
gacaacagcaacatccaggcggaggaggtgtggccaggagtggtttacgctctggctgct
accatgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaag
accctgtcccagcgcatcggcatgaatttcgagaccccggaagcgttgtacggtgagaag
cgctatcgctccattggctatatgcgtccgttgagcatttggtccatgcaggtggcattg
gagcgacggcgagcccaacgcgactaa

DBGET integrated database retrieval system