KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33090Help
Entry
Dmel_CG33090      CDS       T00030                                 

Definition
CG33090 gene product from transcript CG33090-RB (EC:3.2.1.21 3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:dme00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:dme00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:35A4-35A4
AA seq 948 aa AA seqDB search
MAEPLAVETKPLSNGNANGNAVGIAESASAVFQEKLKLQQQEESNEIAAVPKYGLKLKFD
HVWPEKRIQNVRASIRQTLPMVPLVCRYAAYYWKVSREGRRVYMDYYYMENGKQIYGVPI
GGIGGGTIGRGYAGEFCRFQMRPGIYEYNVVLANQFIVTIKDPKGCTIFQSLLSKCSTRD
KTSDPDGDPDGERTKCQLPNCSSRAKQPLSAWHSNIEDTRCSYTGLYPRSWTEYDLSHYG
VRLTCRQVSPVIPHEYRESSLPCAVFVWSVENVCDQERKVSITFTFKNGTGNKKQDAEGG
AESQLISEGNAKGVSIRQKISEMPCSYNLACRVLPEISITRCPQFDPAGNGEQLWAQLKE
HGQLSEHPTSEALKTKDIGVAVCGQVALKPMASHDLEFVLAWDMPKIQFPRKMQTHTRYY
TKYFDDSGDSGPRICEYALRQYSTWERLIDAWQRPILNDETLPDWYKCAIFNQLYFISDG
GTIWLKCDSSLGKELAYDDPRLAYGRFGYLEGHEYRMYNTYDVHFYASPALAHLWPNLQV
SLQYDFKDAIAAELNDTRKMLYDGKVMPRKVKNCVPHDLGDPDEEPFTLINCYNIHDVND
WKDLNTKFVLQVYRDYYVLNELAQAQSDNASKFSSIEFIDKESLYELYSQDNKRKNSADE
KQQNRKSASMYINETNGKVYLMDAIGYLKAMYASCKAIMERTIEYDKDNDGLIENTKMPD
QTYDSWVMDGPSAYCSGLWLAALQAMSAMATILDQPNDCLRYQDILEKGKRSLEEKLWNG
SYYRFDLSHSHRDTIMADQLCGHWYLKSCGFDYEIYPKENVRTALKRIYDNNVMGFHEGN
IGAANGFIANASEPTKPGHVDNSNIQAEEVWPGVVYALAATMIQEGMFEEAFQTAGGMYK
TLSQRIGMNFETPEALYGEKRYRSIGYMRPLSIWSMQVALERRRAQRD
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacctttagcagtggaaaccaagccgctgagcaacggaaatgccaatggaaac
gcagtgggaatcgccgaatccgccagcgctgtcttccaggagaagttgaagctccagcag
caggaggagtccaacgagatcgcggcagtgccgaagtacggactcaagctgaagttcgac
catgtgtggccggaaaagaggatccagaatgtgcgggcctccatcaggcaaacgctgccc
atggtgccactcgtctgcagatatgcggcctactactggaaagtgtcgcgtgaaggtcgt
cgggtgtacatggactactactacatggagaatggcaagcagatctatggagtgcccatc
ggcggaattggaggtggtacgattggcaggggctatgccggcgagttctgccgtttccag
atgcgtcccggcatctacgagtacaatgtggtgctggccaatcagtttatcgttaccatc
aaggatcccaaaggatgcaccatctttcagagcctcctctcgaagtgcagcaccagggac
aagaccagcgatccggatggcgatccggatggggaaagaactaaatgtcaactgcccaat
tgcagcagtcgcgccaagcagccgctgagtgcctggcactcgaacatcgaggacacgcgc
tgcagctacacgggtctctatcctcgctcctggacggagtacgatctgtcccactatgga
gtccgtctgacctgtcgccaggtatcgccggtaataccgcatgagtaccgcgagtccagc
ctaccgtgcgccgtcttcgtgtggagcgtggagaatgtttgcgaccaggagcgcaaggtg
tccatcacgttcactttcaagaacggcacagggaacaagaaacaggatgcggagggcgga
gccgagtcgcagctaatcagcgagggcaacgccaagggagtctccatcaggcagaagatc
tctgagatgccctgcagttataatctggcatgtagggtccttcccgagatcagcatcacg
cggtgcccccagttcgatccggccggcaacggtgagcagttgtgggcacagctcaaggag
catggccagcttagcgagcatcccacctcagaggcactaaaaaccaaagatataggcgtg
gctgtctgtggccaggtggccctgaagccaatggcatcccacgatctggagtttgtgctg
gcctgggatatgccaaagattcagttccccaggaagatgcagacccatacacgctactac
accaagtacttcgatgacagcggtgattccggtcccaggatctgcgagtatgcactcagg
cagtattccacctgggagcgattgattgatgcgtggcaaagacccattctcaatgatgaa
acccttcccgactggtacaagtgtgccatcttcaatcaactttacttcatctcggatggc
ggaaccatttggttgaaatgtgattcttcgctgggcaaggaactggcttatgatgatccc
cgactggcttatggccgtttcggttacctggaaggccacgaataccgcatgtacaacacc
tacgatgtccatttctatgcatcgccggctctggcccacctgtggcccaatcttcaggtc
agtctgcagtatgacttcaaggatgccattgccgcagaactaaacgatactcgtaaaatg
ctttacgatggcaaggtgatgccgcgcaaggtcaagaactgtgtgccccacgatctcggg
gatcccgatgaggaacccttcaccttgatcaactgctacaacatacacgatgtgaatgac
tggaaggatctcaatacgaagtttgtgctgcaggtgtatcgggactactatgtcctcaat
gaactggcccaggcccagtcggataatgcaagcaagttcagctccatcgagtttatcgat
aaggagagcctttatgagctgtacagccaggacaacaagcgcaagaattcagctgatgaa
aagcaacaaaaccgtaaatctgcatcgatgtacatcaacgaaaccaatggaaaggtgtat
ctaatggatgccattggctacttgaaggccatgtacgcatcgtgcaaggccattatggag
cgaaccattgagtacgataaggacaacgacggtctgatcgagaacacaaagatgccggac
cagacctatgactcctgggtgatggacggaccgagtgcctactgctccggtctctggctg
gctgctctgcaagccatgtccgccatggctaccattctggaccagccgaacgattgcctg
cgctatcaggatattttggagaagggcaagcgatcgctggaggagaagctctggaatggc
agttactatcgctttgatctttcgcacagtcatcgggatacgatcatggccgatcagtta
tgtggtcattggtatctaaagtcctgcggcttcgattacgagatctatccgaaggagaat
gtgcgtactgcccttaagaggatctatgacaacaatgtgatgggctttcatgagggcaat
atcggagcggccaatggcttcatagccaatgccagcgaacccaccaagccgggtcacgtg
gacaacagcaacatccaggcggaggaggtgtggccaggagtggtttacgctctggctgct
accatgatacaggagggcatgttcgaggaagccttccagaccgccggcggaatgtacaag
accctgtcccagcgcatcggcatgaatttcgagaccccggaagcgttgtacggtgagaag
cgctatcgctccattggctatatgcgtccgttgagcatttggtccatgcaggtggcattg
gagcgacggcgagcccaacgcgactaa

DBGET integrated database retrieval system