KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33100Help
Entry
Dmel_CG33100      CDS       T00030                                 

Gene name
4EHP
Definition
eIF4E-Homologous Protein
Orthology
K03259  
translation initiation factor 4E
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG33100 (4EHP)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG33100 (4EHP)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG33100 (4EHP)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmel_CG33100 (4EHP)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmel_CG33100 (4EHP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:95E1-95E1
AA seq 248 aa AA seqDB search
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKE
TQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANS
KGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPSIQVACSSRPII
CIIYTRFVVQFGKCKIIIVTNNNKRNVYEFLTIIVIKIHEEMLSLLSRKCKFVNAPNELV
TRIGRFLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaaagtagccaacaagcagtacgagacgaaaaactggccagatattgtc
gacagcgacgacagcgatgtggataatcagatagatgtggacaacctgccaccactggag
gtgggtcccggcgagaaccggctgcagcacacatactgcctctggttctctcgcaaggag
acgcagcgcgcggccgccgactacagcaagtcgctgcacatggtcggccggtgcgccagc
gtgcagcagtggtggtcgctctactcgcacctcatccggcccaccgccctgaagccctac
cgggagctcctcctcttcaagcagggcatcataccgatgtgggaggacccggcgaacagc
aagggcggccagtggttgatacgactacgcaagaacaaggtcgaccgggcctgggagaac
gtttgtatggcgatgctcggggagcagttcctcgtcggcgacgagatatgcggagtcgtg
ctacagacgaaatatccgaatccaagcatccaagtagcatgctcatcaaggcctataatc
tgcattatctacacacgttttgtagtacaattcggaaaatgcaaaatcattatagttact
aataacaataaacgcaatgtgtatgagtttttgacaattattgtgattaagatacacgaa
gaaatgctttcgcttctaagtaggaaatgcaaatttgttaatgcaccaaacgaactggtc
acgcgaattggtcgatttctgttttga

DBGET integrated database retrieval system