KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33138Help
Entry
Dmel_CG33138      CDS       T00030                                 

Gene name
CG33138, AGBE
Definition
1,4-Alpha-Glucan Branching Enzyme (EC:2.4.1.18 3.2.1.-)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dmel_CG33138 (CG33138)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dmel_CG33138 (CG33138)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG33138 (CG33138)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:49F4-49F4
AA seq 685 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLEDWLNKINQSEGGLDGFSTAYKHYGLHFQ
PDNSVIAREWAPGARDVYLTGDFNNWHWESHPFKKLDFGKWELHLPPNEDGSPAIKHLSE
IKIIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHPGPPRPK
SLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTS
FYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGA
RGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSG
DYNEYFGLNVDTDALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTLSDSSVIIDRGLALHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNEAEERYGWLHSGPAWVSWKHEGDKIIA
FERAGLVFVFNFHPQQSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEG
YAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcatgagatccgtcgccgtcatggcgtgctcgaggattggctgaataagataaaccaa
agcgagggcggactggatggcttttcgacggcttacaagcactacggacttcacttccag
ccggataattcggtgattgcccgcgagtgggcacctggagccagagatgtctatctcacg
ggtgacttcaacaactggcactgggaatcgcatccatttaaaaagctcgactttggcaag
tgggagctacacctgccccccaacgaggacggcagtccggccatcaagcacttgagcgaa
attaagattataattcgcaaccattccggtcaattgctggaccgcctgtcgccctgggcc
aagtacgtggtgcagccgcccaagtcggccaatcagggggtcaactacaagcagtacgtg
tgggagccaccgtcctacgagcgctaccaacgccagcatccgggtccgccaagacccaag
tcgctcaggatctacgagtgccacgtgggtatcgcctcccaggagccgcgggtcggcagc
tacgacgagttcgccgatcgcatcgtgccgcgcatcaagcgtcagggctataattgcatc
caggttatggccatcatggagcacgcctactacgccagttttggctatcaagtgaccagc
ttctatgcggcctccagccgttatggcaacccggagcagctgaagcgcatgatcgacgtg
gcacactcgcacggcctgttcgttctgctcgatgtggtccactcgcatgcctccaagaac
gttcaggacggtctgaaccagttcgatggcaccaacagttgcttcttccacgacggagcc
cgtggcgagcactcgctgtgggacagtcgtctcttcaactacgtggagtacgaggtgctg
cgtttcttgctatccaacctgcgttggtggcacgacgagtacaacttcgatggctatcgc
ttcgacggagtgacctctatgctataccattcccgtggcattggggagggcttcagcggc
gattacaacgagtactttggcctgaatgtcgacacggatgccctcaattatctgggactg
gccaatcatctgctgcacaccatagattcgaggattatcaccattgcagaggatgtttct
ggaatgcctaccttgtgtcgccccgtatcagagggtggtatcggtttcgactaccgcttg
ggtatggccatcccagacaagtggatcgaactgctgaaggagcagagtgacgatgagtgg
gacatgggcaacttggtgcacacgctgaccaaccgtcgctggatggagaacacagtggcc
tacgcagagtcccacgatcaagcgctagtgggcgacaagacgatcgccttctggctgatg
gacaaggagatgtatacgcacatgtcgacgttgtcggactcctcagtgatcatcgaccga
ggactggcgctgcacaagatgattcgtctgatcacgcacgccctgggaggcgaggcgtac
ctgaactttatgggcaacgagttcggacatccagaatggctggacttcccacgcgttggc
aacaacgattcgtatcactatgctcgccggcaatggaatcttgtggacgacgatctgctg
aagtacaagtacctcaacgaattcgatcgagccatgaatgaggccgaggagcgctacggc
tggctgcattccggacccgcttgggtcagctggaagcacgagggcgacaagataatcgct
ttcgagcgtgccggcctggtgttcgttttcaacttccatccacagcagagtttcaccgga
taccgtgtgggcaccaactgggcgggcacctaccaggcggtgctctcctcagacgatcct
ctcttcggcggccacaaccgcatcgatgccaactgcaaacatccctccaatccggagggc
tacgccgggcgctccaatttcattgaggtctacacaccatcacgcacagccgtggtttat
gcccgcgtcagtgactag

DBGET integrated database retrieval system