KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33238Help
Entry
Dmel_CG33238      CDS       T00030                                 

Definition
(RefSeq) Ste:CG33238
  KO
K03115  
casein kinase II subunit beta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ribosome biogenesis in eukaryotes
Mitophagy - animal
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    Dmel_CG33238
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG33238
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    Dmel_CG33238
Ribosome biogenesis [BR:dme03009]
 Eukaryotic Type
  90S particles
   Kinase
    Dmel_CG33238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
X
AA seq 172 aa AA seqDB search
MSSLENNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSS
GLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSAVWG
KSTVKIHCPRCKSNFHPKSDTQLDGAMFGPSFPDIFFSMLPNLTSPLDDPRT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcttggaaaacaacaacagcagctggatcgattggttcctcgggatcaagggc
aaccagttcctctgccgcgtgcccaccgactacgtgcaggatacgttcaaccagatgggc
ttggagtatttcagcgagatactggacgtgatcctgaagccggtgatcgatagttcctct
ggcttgttgtacggcgatgaaaagaagtggtacggcatgattcacgcccgatacatcagg
tcagagcgtggcctgattgctatgcaccgaaaatatttgcgaggagattttggatcgtgt
cccaatatctcctgttataggcagaacaccctgccagtgggcctcagcgctgtatggggc
aagtcaaccgtcaagatccactgcccacggtgtaaaagcaactttcatccgaagtctgat
acacagctggacggagcgatgttcgggcccagcttcccggacatcttcttctcgatgctg
ccgaacttgacatcgcccctggacgacccacgtacctag

DBGET integrated database retrieval system