KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33238Help
Entry
Dmel_CG33238      CDS       T00030                                 

Gene name
Ste:CG33238
Definition
CG33238 gene product from transcript CG33238-RB
Orthology
K03115  
casein kinase II subunit beta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ribosome biogenesis in eukaryotes
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    Dmel_CG33238 (Ste:CG33238)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG33238 (Ste:CG33238)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:12D3-12D4
AA seq 172 aa AA seqDB search
MSSLENNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSS
GLLYGDEKKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCYRQNTLPVGLSAVWG
KSTVKIHCPRCKSNFHPKSDTQLDGAMFGPSFPDIFFSMLPNLTSPLDDPRT
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcttggaaaacaacaacagcagctggatcgattggttcctcgggatcaagggc
aaccagttcctctgccgcgtgcccaccgactacgtgcaggatacgttcaaccagatgggc
ttggagtatttcagcgagatactggacgtgatcctgaagccggtgatcgatagttcctct
ggcttgttgtacggcgatgaaaagaagtggtacggcatgattcacgcccgatacatcagg
tcagagcgtggcctgattgctatgcaccgaaaatatttgcgaggagattttggatcgtgt
cccaatatctcctgttataggcagaacaccctgccagtgggcctcagcgctgtatggggc
aagtcaaccgtcaagatccactgcccacggtgtaaaagcaactttcatccgaagtctgat
acacagctggacggagcgatgttcgggcccagcttcccggacatcttcttctcgatgctg
ccgaacttgacatcgcccctggacgacccacgtacctag

DBGET integrated database retrieval system