KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33486Help
Entry
Dmel_CG33486      CDS       T00030                                 

Gene name
asparagine-synthetase
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dme00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:78C1-78C2
AA seq 558 aa AA seqDB search
MCGIFAIFSRDGEPIPTQILHGSKHSLRELAYRQSGKHRHRGPDSTGVYVNSLEGVAMIH
ERLRIIGVEMGDQPFVSEDGNLILVANGEIYNYLELSAEIAKKRGSYNPMSDCHVILELY
QDYGKDLLQYITGMFAFALYDRKTKEVLLARDPFGIIPMYVGEDASGNLWVASEMKCLVD
TCSKVETFTPGEARFGKVGDFKTCWQFQQSWIKEVPTQTCELSLLRANLEFAVRSHLQCD
VQMGALLSGGVDSSLIASIATKIMRERDPNFRLKTFSVGLRDAPDFQAARSVAKYIDSDH
KEIIFEIDEALDGIRDIIYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPSYNDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPEDKIPGPLNKFGEVQQKRLEKYVLRAAFADNYLPDEVLWRQKEQFSDGVGYDWIDSI
RRVATSHVSDQEFSAAALRFPFNTPTTKEAFYYRCIFAEQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQVNKN
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgccatattttcgagggatggggagccgatacccacgcaaatcctc
catggaagcaaacacagtttaagggaactggcctatcgacagagtggcaagcatcggcat
cggggtccagattccacgggggtctatgtgaattccttggaaggggtggccatgattcat
gaacgcctgcgaatcattggcgtggaaatgggcgaccaacccttcgtctctgaagatggt
aacctcatcctggtggccaatggagagatctacaattatctggagctttcggctgagatt
gcgaaaaagcgtggctcctacaaccccatgagcgattgccacgtgatactggaactgtac
caggattatggaaaggatcttctgcaatacatcactggaatgtttgcttttgccttgtac
gataggaagaccaaggaagtgcttcttgcccgagacccctttggcattatacccatgtat
gtgggtgaggatgcgtcgggaaacctttgggtggcctcggagatgaagtgcctggtggat
acctgctccaaagtggagactttcacacctggcgaggctcgtttcggtaaagttggtgac
tttaaaacatgctggcagtttcagcagtcttggatcaaggaggtgcccacacaaacctgc
gaattatccctactgcgagccaacttggagtttgccgtgcgcagtcatctgcagtgcgat
gttcaaatgggagccctgctatccggcggagtggattccagtcttatagcctccatagcc
acgaagataatgcgcgaacgggatcccaacttccggctgaaaacattctctgtgggtcta
agggatgcacccgacttccaggcggccaggagtgtggccaaatatatagacagcgatcac
aaggagatcatattcgagatcgacgaagctctggatggcattagggatattatttaccac
cttgaaacctatgatgtgaccacagtgagatgtagtttgcccatgctgctactagctaga
tatatcaagagcacaggcatcaagatgatcctctccggcgaaggagccgatgagatcttt
ggagggtatttatacttccacaaggccccaagctacaacgatttccacgaggagctggtg
aagagagtgcgccagctgcatttatccgattgtttgcgggccaacaaggtggccatggcc
aagggcgtggagctgcgagtgccctttctggacacggggttcgttaaccatgtgatgcaa
atccgaccggaggataagatacccggacccctcaacaaattcggggaagtacagcaaaag
cgattggagaagtatgtcctgcgagctgcctttgcggataactatctgcccgatgaagtc
ctctggcgccagaaggagcagttctccgacggagtgggctacgattggatcgacagcatc
cgcagggtggccaccagccatgtcagcgatcaagaattctccgcagccgccctacgcttc
ccctttaacacgcccacaaccaaggaggccttctactatcgctgcattttcgccgaacaa
ttccccggagaatcggcggcccgaaccgtggtcagatgggtgccacgcctcgattggggc
tgtccggaggatccatccggacgggcacaggccgtccaccaggtcaacaaaaactga

DBGET integrated database retrieval system