KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33892Help
Entry
Dmel_CG33892      CDS       T00030                                 

Gene name
His2B:CG33892
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmel_CG33892 (His2B:CG33892)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG33892 (His2B:CG33892)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1931
Motif
Other DBs
NCBI-GeneID: 3772166
NCBI-ProteinID: NP_001027325
FlyBase: FBgn0053892
UniProt: P02283
Structure
PDB: 

Jmol
Position
2L
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaccgacaagaaaaagaagcgcaaaaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctagctcac
tacaacaagcgctcgaccatcaccagtcgggagatccaaacggctgttcgcctgcttttg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctctaaataa

DBGET integrated database retrieval system