KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33898Help
Entry
Dmel_CG33898      CDS       T00030                                 

Gene name
His2B:CG33898
Definition
CG33898 gene product from transcript CG33898-RA
Orthology
K11252  
histone H2B
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG33898 (His2B:CG33898)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:39D4-39D4
AA seq 123 aa AA seqDB search
MPPKTSGKAAKKAGKAQKNITKTDKKKKRKRKESYAIYIYKVLKQVHPDTGISSKAMSIM
NSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYT
SSK
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgaaaactagtggaaaggcagccaagaaggctggcaaggctcagaagaacatc
accaagaccgacaagaaaaagaagcgcaaaaggaaggagagctatgccatctacatttac
aaggttctcaagcaggtccatcctgacaccggaatttcgtcgaaggcgatgagcataatg
aacagctttgtaaatgatattttcgagcgaattgctgccgaagcgtctcgtctagctcac
tacaacaagcgctcgaccatcaccagtcgggagatccaaacggctgttcgcctgcttttg
cctggagagttggccaagcatgctgtcagtgagggaaccaaggctgtcaccaagtacacc
agctctaaataa

DBGET integrated database retrieval system