KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33931Help
Entry
Dmel_CG33931      CDS       T00030                                 

Gene name
Rpp20
Definition
CG33931 gene product from transcript CG33931-RA (EC:3.1.26.5)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG33931 (Rpp20)
   03008 Ribosome biogenesis in eukaryotes
    Dmel_CG33931 (Rpp20)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     Dmel_CG33931 (Rpp20)
Ribosome biogenesis [BR:dme03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     Dmel_CG33931 (Rpp20)
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    Dmel_CG33931 (Rpp20)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    Dmel_CG33931 (Rpp20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:18E5-18E5
AA seq 167 aa AA seqDB search
MMGSNYPEHGTKPRSAKYHKQQNHRVVRKQPPRPAVSDRHNIYITSKTDFKAQQRRCEEL
INSGAHEIFLHCMGFSVTRGLNIALRLVQNSDGALSYAINTSTVQLVDELHPLCDAEDIT
FRQRNNSALHIKILNNSLFDIAVPQPSQSQTQAQSLGQFRGKAKARQ
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatgggaagcaattatcccgagcacgggaccaagccgagatccgccaaataccacaaa
caacagaaccaccgagtggtgcgcaagcagccgccgcgtcccgctgttagcgaccgccac
aacatctacatcaccagcaagacagactttaaggcccagcagcgccgctgcgaggagctg
attaactccggcgcccacgagatctttctgcattgcatgggcttctccgtaacccgcggc
ctcaatatcgccctacgcctcgtccagaattctgacggcgcccttagctacgccatcaac
acctccaccgttcagctggtggacgaactgcacccgctgtgcgatgccgaggacataacc
ttccgccagcgcaacaactcggccctgcacatcaagatcctcaataacagtctcttcgac
atcgccgtgccgcaaccgtcgcagtcccagacgcaagcccagtccctgggccagttccga
ggcaaggcgaaggccaggcagtag

DBGET integrated database retrieval system