KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33970Help
Entry
Dmel_CG33970      CDS       T00030                                 

Gene name
CG33970
Definition
(RefSeq) uncharacterized protein, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 DUF3533
Motif
Other DBs
NCBI-GeneID: 43186
NCBI-ProteinID: NP_001034070
FlyBase: FBgn0053970
UniProt: Q9VBF7
Position
3R
AA seq 518 aa AA seqDB search
MLAEESPDYLRQQYNADSLEDVFLKLSVLQNMGKRRRSSIAQEIVEQVTVPAISNPALDM
SDEQHAAEISGEFGDNISMSSAARDPISTTAPAAPPLPPPQEIPTSFWYNLHVMQSHHLH
ALIWKNFLWMMRNVGVMLFIVGLPVVQILLFCYAIGHDPTGLKLAVANHEMSGEMIMEQF
CPVHTGCNQTMLSCRYLDMLVKNKSMVVQYVTDDEMAYEEVRKGRAWAALVIQPNYTASL
MERVEDGRYAEDGTIESSDLAVRMDWSNQQISQLLYRDLQYTFFNFVGDMLSDCDVNPKL
GRVPVDFQHPVYGYRNPNFTDFAAPGVILTIIFFLAVAVTSGAMLIDRNEGMLERCLVAG
ITGPEILLSQVVTQFTVMLSQTTFVLIVSFYFFELTLVGNIWLVVALCILNGLCGMSFGF
VISCAVDTERTATYVAMGSFLPIVMLCGIIWPIEGMFPLLQFFTAFLPLTKPTESMRSIL
QRGWGIDNPVVYNGFISISSWVLVFLVLTILLLKFKKG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctggcagaggaatcgccggactatctgcgtcagcagtataatgccgactcgctggag
gatgtcttcctgaagctctcggttttgcagaacatgggaaaacgccgccgatcgtcgata
gctcaggaaattgtggaacaggtaacggtgccggcgatctctaatcccgccttggacatg
tccgatgagcagcatgccgccgaaatttccggcgagttcggtgacaacatttcaatgtcg
tccgcggctcgagatccgatcagtacaaccgcacccgcagctccgcctttgccaccgccc
caggaaatacccacatccttctggtataatctacatgtgatgcagtcgcatcacctgcac
gccctcatctggaaaaacttcttgtggatgatgcgcaacgtgggggtgatgctgttcatc
gtgggtctgcccgtggtgcagatactgctcttctgttacgccatcggccatgatcccact
ggcctcaaattggccgtggcgaatcacgagatgtcgggggaaatgattatggaacaattc
tgtccagtgcacaccggatgcaatcagacgatgctgagctgccgttatctcgatatgctg
gtcaagaacaagagcatggttgtgcaatatgtgaccgacgatgaaatggcttacgaagaa
gtaagaaaaggtagagcctgggccgccctggtaatccaacccaactataccgcatctctg
atggaacgcgtggaggatggtcggtatgccgaagatggaactattgagtcctcggaccta
gcagtacgaatggactggtcaaatcaacaaatctcacagttgctgtaccgcgatctccag
tacacattcttcaactttgtgggtgacatgctaagcgactgtgatgtgaatccgaaacta
ggtcgtgtgcccgtggacttccagcatcctgtttatggctatcgcaatcccaatttcaca
gactttgctgctcccggagttatcctgacgatcatcttctttttggccgtggctgttacc
tccggagctatgttaattgatcggaatgagggcatgttggagcgttgtttggtagctgga
atcacgggtccggagattcttctctcccaggtggtcacccagttcacggtgatgctaagc
cagacgaccttcgtactgattgtcagcttctacttcttcgaacttaccttggtgggtaac
atatggctggtggtggcactctgcatcctgaatggactgtgtggcatgagcttcggattc
gttatttcctgtgctgtggacacggagcgaactgcgacttatgtggcgatgggctcgttc
ttgcccatcgttatgttgtgcggcattatctggccgatcgagggcatgttcccgcttctg
cagttcttcacagccttcctgccgctcaccaaaccaacggaatcaatgcgatccatactg
caacgcggctggggcatcgacaatcccgtcgtctacaatgggtttatttccatttcttcc
tgggttctggtattcctcgtacttaccatcctgctgctcaagttcaagaagggataa

DBGET integrated database retrieval system