KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3399Help
Entry
Dmel_CG3399       CDS       T00030                                 

Gene name
capu
Definition
cappuccino
Orthology
K02184  
formin 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG3399 (capu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
Position
2L:24C8-24C9; 2L:2-8 cM
AA seq 1280 aa AA seqDB search
MGNSQNRAANVDEKSPPGGASLVRMGITGGGGAGEVGVALSERRGSRVRVLSRLMGQKRI
REAFLHSPKLGSSSEVNLQGAGNGSSDWIAAETEVEHGQLDCSAEPADFHPVDELIISKH
YLNTAAKEHNNPKAKRDRPLSEISVTSVDTLSPNTAKAVLELQKRCRADKLACLSLTRVT
YLSIANDLQEVEEPDRASILHDTDLLVAPNSPAESSPDEELMALQLGKKLAQVLGSGAGS
PLTPGTMEPCAAGSGSPLANGELFNVSKAKKVELQNLSSRFTAAVTQTPPGVTSSTPNES
GVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNSAASENVEDDTAPLPLPPPP
PGFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPNLCPTSDETTLLATPCSSSLTVA
TLPPEIAVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFEGQMLIKWLISTMQSNPKSS
SGDANQELFNTLALQFCNNLKYVGVLKQISNEHLDCGFSPYEMYQWTHTEQPTTSLPLTP
GKLDKVAAWPFSSTPSGIRALESASLASLGAGGVAGSLATIATASTASSDNQKTLQQILK
KRLLNCTTLAEVHAVVNELLSSVDEPPRRPSKRCVNLTELLNASEATVYEYNKTGAEGCV
KSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKPHAVAPPPPPPPPPLHAFVA
PPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAPIEGGGGIPPPPPPMSASP
SKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYWTRIVTSAPPAPRPPSVANS
TDSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETPLDNIDEFTELFSRQAIAPV
SKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEHAIYHIDTSVVSLEALQHMS
NIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASERISCIVFQAEFEESVTLLFR
KLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQADGFNLDILGKLKDVKSKE
SHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAAQMDFEEVQQQIFDLNKKFL
GCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQSLDECRDLFLETMRFYHFS
PKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNELMKKSKQAQIESRRNVSTK
VEKSGRISLKERMLMRRSKN
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggggaattcgcaaaatcgggctgcgaacgtcgatgagaagtcaccgccaggtggcgcc
agtctagtgcgaatgggaatcacagggggcggtggcgctggcgaagtgggcgtggccctc
tcggaaaggcgtggcagtcgagttcgcgtgctcagccgtttgatgggtcagaagcgcatt
cgcgaggcattcctacactctccgaaattgggatcgagttccgaggtcaatttgcagggc
gctggcaacggaagtagcgattggatcgcggcggaaacggaagtggagcatggacaactg
gattgcagcgccgagccagcagattttcatcccgtggacgaactgatcatatcgaagcac
tatctaaatacagcagcgaaggaacataataatccgaaagccaaacgcgatcgtccactg
agcgaaatcagtgtgacgtcggtggacaccctatcaccgaataccgcaaaagccgtgctc
gagctgcagaaacgctgccgagctgataagttggcctgcctgagcctaactcgcgtcacc
tacctcagcatagccaatgatctgcaggaagtcgaggagccggatcgggccagcatattg
cacgatacggatcttttggtagcacccaatagcccggcggaaagttcgccggacgaggaa
ctcatggccttgcagctaggcaagaagttggcccaggttttgggcagtggagcgggctca
cctttgacccccggcacaatggagccttgtgcagcgggttcgggctcaccgctggcaaat
ggagagctcttcaacgtctccaaggccaaaaaggtagagctacagaacctttcgtctcga
ttcacagccgccgtcacccaaacaccgccaggtgtcacgtcatccactcccaatgaatca
ggagtcacaggacctgcaggacctttgggggctacaacatcctcgccgtcgctggaaacg
caatcaactgttataatttcgtttaaatcatctcaaacacctgtgcagtctcaaacgaat
tctgcagcctccgaaaatgttgaggatgacacagcgcccctgccacttccaccgccgccc
cccggcttcggtacgcccaccacgccccttttgtcaagcaatgtgctgaagaaggtcgcc
agcttcacggtcgagaagtcttcggcgggcaataatagctcgaatcctccgaatttgtgc
cccaccagtgacgagaccaccctcttggccacaccatgttcttcatcgctgacggtggca
accctgccgcccgaaatcgccgtgggcgcagcggcggggggcgtggccgggggtgctggt
tcgcgacgcggctcatcttatgtaccggaaaagttaagcttcgctgcatatgaaaagttc
gaaggtcaaatgctaataaaatggctaatctcaacgatgcaaagcaatccgaagagttcc
agcggtgatgctaatcaggaattatttaatacactggcgttgcagttctgcaataatctc
aaatatgtcggcgtccttaagcagatctccaatgagcacttggattgcggatttagcccc
tatgaaatgtaccaatggacgcacacggagcagccaaccacctcattgcccctgacccct
ggcaagctggacaaggtggcggcttggccattttccagcacaccatccggtattcgagcg
ctggagtccgcatcgctggcgtccttgggagcaggtggggtggcgggttctttggcaacc
attgccaccgcatccacagcctcatcggacaatcagaaaaccctgcagcagatcctcaag
aagcgtctactcaactgcacgaccttggccgaagttcatgcggtggtaaacgagctgctg
agcagcgtggatgaaccaccgcgtcgtccatcgaagagatgtgtgaatctcacggagctg
ctgaacgccagtgaggctaccgtttatgaatacaacaagactggagcggagggctgtgtg
aagagctttacggatgcggaaacccaaacggaaagcgaggattgcgagggcacctgcaag
tgcggccaatcctcgacgaaagtgtccgataacgaaagtgcaaaggaagatggggaaaag
ccccacgccgttgccccgccgcctccgccacctcctccgccgctgcacgcctttgttgcg
ccgcctcctcctcctccaccaccaccaccacctcctccgccactggccaactatggagca
ccaccaccgccgccacctccgcctccgggcagtggtagtgccccgccgccacctccaccc
gcacccattgaaggcggcggcggcataccgcctccaccaccgcccatgagtgcatccccc
tccaagacgacaatctcacccgctccactgcccgatcccgccgagggcaattggttccat
cgcacaaataccatgcgcaagagtgcagttaacccgccgaagccaatgcgtcctttatat
tggacacggatagtgacgagtgcgccgcctgcgccacgccccccatcggtggccaattcc
acggacagcacggagaacagcgggagctcacccgatgagcctccggctgcgaatggtgca
gatgctccgcccacagcgccaccggccaccaaggagatctggacggagatcgaggaaacg
ccattggataatatcgatgagttcacggaactcttttcccgccaagccattgcgcccgtt
agcaagcccaaggagctgaaggtcaagcgagccaagtccatcaaggtactcgatccggag
agatcgcgaaatgtgggcataatctggcggagtttacatgtgccgtccagcgaaatcgag
catgctatctaccacatagacacatcggtggtcagtttggaggcgctgcagcacatgagc
aacattcaggcgacagaggatgagctgcagagaatcaaggaggcagccggcggcgatatt
ccgctcgatcatcccgaacagttcctgctggacatatccctaatttccatggccagcgag
aggatttcctgcattgtctttcaggcggaattcgaggagtccgtaacgctgttgtttcga
aagctggaaacggtgtcccagctatcgcagcaattgatcgagagcgaggatttgaagctg
gtcttctccatcatccttacgctgggcaactatatgaacggtggcaaccggcagcgcgga
caagcggatggcttcaatctggatattctgggcaagcttaaggatgtcaagtccaaggaa
tcgcacaccaccttgctccatttcattgtgcgcacctacattgcgcagcggcgaaaggag
ggagtgcatcccctggagatccgcttgcccatcccagagccagccgatgtggagagagcc
gcacaaatggacttcgaggaggtgcagcagcagatcttcgatctcaacaagaagttcttg
ggttgcaagagaacgacggccaaagttttggccgcctcgcgtcccgagatcatggagccc
ttcaagtccaaaatggaggagtttgtggagggggcggacaaatcgatggccaagctgcat
caatcccttgacgagtgtcgcgatctctttttggagaccatgcgcttctaccacttctca
cccaaagcctgcaccctaacgttggcccagtgcacgcccgaccagttcttcgagtactgg
acgaatttcaccaatgatttcaaggacatttggaagaaggagatcaccagtctcctgaat
gaattaatgaagaaatcgaagcaggcccaaatcgaatcgcgtcgcaacgtatccaccaag
gtggagaagtccggacggatttcgctgaaggagcgcatgctgatgaggcgtagcaagaac
tag

DBGET integrated database retrieval system