KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3399Help
Entry
Dmel_CG3399       CDS       T00030                                 

Gene name
capu
Definition
(RefSeq) cappuccino
  KO
K02184  
formin 2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG3399 (capu)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     Dmel_CG3399 (capu)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:24C8-24C9; 2L:2-8 cM
AA seq 1059 aa AA seqDB search
MALQLGKKLAQVLGSGAGSPLTPGTMEPCAAGSGSPLANGELFNVSKAKKVELQNLSSRF
TAAVTQTPPGVTSSTPNESGVTGPAGPLGATTSSPSLETQSTVIISFKSSQTPVQSQTNS
AASENVEDDTAPLPLPPPPPGFGTPTTPLLSSNVLKKVASFTVEKSSAGNNSSNPPNLCP
TSDETTLLATPCSSSLTVATLPPEIAVGAAAGGVAGGAGSRRGSSYVPEKLSFAAYEKFE
GQMLIKWLISTMQSNPKSSSGDANQELFNTLALQFCNNLKYVGVLKQISNEHLDCGFSPY
EMYQWTHTEQPTTSLPLTPGKLDKVAAWPFSSTPSGIRALESASLASLGAGGVAGSLATI
ATASTASSDNQKTLQQILKKRLLNCTTLAEVHAVVNELLSSVDEPPRRPSKRCVNLTELL
NASEATVYEYNKTGAEGCVKSFTDAETQTESEDCEGTCKCGQSSTKVSDNESAKEDGEKP
HAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPA
PIEGGGGIPPPPPPMSASPSKTTISPAPLPDPAEGNWFHRTNTMRKSAVNPPKPMRPLYW
TRIVTSAPPAPRPPSVANSTDSTENSGSSPDEPPAANGADAPPTAPPATKEIWTEIEETP
LDNIDEFTELFSRQAIAPVSKPKELKVKRAKSIKVLDPERSRNVGIIWRSLHVPSSEIEH
AIYHIDTSVVSLEALQHMSNIQATEDELQRIKEAAGGDIPLDHPEQFLLDISLISMASER
ISCIVFQAEFEESVTLLFRKLETVSQLSQQLIESEDLKLVFSIILTLGNYMNGGNRQRGQ
ADGFNLDILGKLKDVKSKESHTTLLHFIVRTYIAQRRKEGVHPLEIRLPIPEPADVERAA
QMDFEEVQQQIFDLNKKFLGCKRTTAKVLAASRPEIMEPFKSKMEEFVEGADKSMAKLHQ
SLDECRDLFLETMRFYHFSPKACTLTLAQCTPDQFFEYWTNFTNDFKDIWKKEITSLLNE
LMKKSKQAQIESRRNVSTKVEKSGRISLKERMLMRRSKN
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggccttgcagctaggcaagaagttggcccaggttttgggcagtggagcgggctcacct
ttgacccccggcacaatggagccttgtgcagcgggttcgggctcaccgctggcaaatgga
gagctcttcaacgtctccaaggccaaaaaggtagagctacagaacctttcgtctcgattc
acagccgccgtcacccaaacaccgccaggtgtcacgtcatccactcccaatgaatcagga
gtcacaggacctgcaggacctttgggggctacaacatcctcgccgtcgctggaaacgcaa
tcaactgttataatttcgtttaaatcatctcaaacacctgtgcagtctcaaacgaattct
gcagcctccgaaaatgttgaggatgacacagcgcccctgccacttccaccgccgcccccc
ggcttcggtacgcccaccacgccccttttgtcaagcaatgtgctgaagaaggtcgccagc
ttcacggtcgagaagtcttcggcgggcaataatagctcgaatcctccgaatttgtgcccc
accagtgacgagaccaccctcttggccacaccatgttcttcatcgctgacggtggcaacc
ctgccgcccgaaatcgccgtgggcgcagcggcggggggcgtggccgggggtgctggttcg
cgacgcggctcatcttatgtaccggaaaagttaagcttcgctgcatatgaaaagttcgaa
ggtcaaatgctaataaaatggctaatctcaacgatgcaaagcaatccgaagagttccagc
ggtgatgctaatcaggaattatttaatacactggcgttgcagttctgcaataatctcaaa
tatgtcggcgtccttaagcagatctccaatgagcacttggattgcggatttagcccctat
gaaatgtaccaatggacgcacacggagcagccaaccacctcattgcccctgacccctggc
aagctggacaaggtggcggcttggccattttccagcacaccatccggtattcgagcgctg
gagtccgcatcgctggcgtccttgggagcaggtggggtggcgggttctttggcaaccatt
gccaccgcatccacagcctcatcggacaatcagaaaaccctgcagcagatcctcaagaag
cgtctactcaactgcacgaccttggccgaagttcatgcggtggtaaacgagctgctgagc
agcgtggatgaaccaccgcgtcgtccatcgaagagatgtgtgaatctcacggagctgctg
aacgccagtgaggctaccgtttatgaatacaacaagactggagcggagggctgtgtgaag
agctttacggatgcggaaacccaaacggaaagcgaggattgcgagggcacctgcaagtgc
ggccaatcctcgacgaaagtgtccgataacgaaagtgcaaaggaagatggggaaaagccc
cacgccgttgccccgccgcctccgccacctcctccgccgctgcacgcctttgttgcgccg
cctcctcctcctccaccaccaccaccacctcctccgccactggccaactatggagcacca
ccaccgccgccacctccgcctccgggcagtggtagtgccccgccgccacctccacccgca
cccattgaaggcggcggcggcataccgcctccaccaccgcccatgagtgcatccccctcc
aagacgacaatctcacccgctccactgcccgatcccgccgagggcaattggttccatcgc
acaaataccatgcgcaagagtgcagttaacccgccgaagccaatgcgtcctttatattgg
acacggatagtgacgagtgcgccgcctgcgccacgccccccatcggtggccaattccacg
gacagcacggagaacagcgggagctcacccgatgagcctccggctgcgaatggtgcagat
gctccgcccacagcgccaccggccaccaaggagatctggacggagatcgaggaaacgcca
ttggataatatcgatgagttcacggaactcttttcccgccaagccattgcgcccgttagc
aagcccaaggagctgaaggtcaagcgagccaagtccatcaaggtactcgatccggagaga
tcgcgaaatgtgggcataatctggcggagtttacatgtgccgtccagcgaaatcgagcat
gctatctaccacatagacacatcggtggtcagtttggaggcgctgcagcacatgagcaac
attcaggcgacagaggatgagctgcagagaatcaaggaggcagccggcggcgatattccg
ctcgatcatcccgaacagttcctgctggacatatccctaatttccatggccagcgagagg
atttcctgcattgtctttcaggcggaattcgaggagtccgtaacgctgttgtttcgaaag
ctggaaacggtgtcccagctatcgcagcaattgatcgagagcgaggatttgaagctggtc
ttctccatcatccttacgctgggcaactatatgaacggtggcaaccggcagcgcggacaa
gcggatggcttcaatctggatattctgggcaagcttaaggatgtcaagtccaaggaatcg
cacaccaccttgctccatttcattgtgcgcacctacattgcgcagcggcgaaaggaggga
gtgcatcccctggagatccgcttgcccatcccagagccagccgatgtggagagagccgca
caaatggacttcgaggaggtgcagcagcagatcttcgatctcaacaagaagttcttgggt
tgcaagagaacgacggccaaagttttggccgcctcgcgtcccgagatcatggagcccttc
aagtccaaaatggaggagtttgtggagggggcggacaaatcgatggccaagctgcatcaa
tcccttgacgagtgtcgcgatctctttttggagaccatgcgcttctaccacttctcaccc
aaagcctgcaccctaacgttggcccagtgcacgcccgaccagttcttcgagtactggacg
aatttcaccaatgatttcaaggacatttggaagaaggagatcaccagtctcctgaatgaa
ttaatgaagaaatcgaagcaggcccaaatcgaatcgcgtcgcaacgtatccaccaaggtg
gagaagtccggacggatttcgctgaaggagcgcatgctgatgaggcgtagcaagaactag

DBGET integrated database retrieval system