KEGG   Drosophila melanogaster (fruit fly): Dmel_CG34139Help
Entry
Dmel_CG34139      CDS       T00030                                 

Gene name
Nlg4
Definition
Neuroligin 4 (EC:3.1.1.- 3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmel_CG34139 (Nlg4)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Dmel_CG34139 (Nlg4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:92D5-92D8
AA seq 1280 aa AA seqDB search
MGESQLLLLLRLLLLPTVLISWMHCAGASTADIYKGARLGHRIVQTRYGRLHGLILPLDS
FRFLRSVEVFLGVPYATPPTKQNRFSPTRAPAPWDGIRISDKYSPVCPQRLPNIQNETAA
LEKMPKGRLEYLKRLLPFLENQSEDCLYLNVFSPVNAGANEKKLPVIVFIHGESFEWSSG
NPYDGSVLASYGEVVVVTLNYRLGILGFLNANPNPHAHARVANYGLMDQMAALHWIQQNI
QKFGGDPNSVTLAGHGTGAACINYLMTSPTMVRGLFHRAILMSGSAYSSWALVEDPVLFA
IKLAKEVNCTIPDDINRHHEQIVDCLRDVPLEDLYLADIQAPNFLTSFGPSVDGVVIRPG
HSNLDIDDLMARNSRRSSADSGFQSSAGGGGGQGGGAGGGGGGGSGSSFGGGYFGGSGAG
TMNMGGHYDVLFGVVTGESIWRFSAHDIQNGFEGERRDKIIRTYVRNAYNYHLNEIFYTI
VNEYTDWDRTSQHPINTRDTAVAALSDAQFVAPIVRAGDILAANSPPPVSSSSTAGSPGA
NAAASTSAGSTQPSGRCYFYVFDYQTKDGDYPQRMGTVHGEDLPYIFGAPLVDGFSHFPQ
NYTKSETALSEAVMIFWTNFARTGNPNEHHRQDSSLPVSKERNRFRSITWENYDPLHQKY
LEIGMKPRIKNHFRAHQLSIWLRLIPELHRAGMEDVIARHNLFRNHDDMDLYEGPVKPDP
FGISTAAGASGSSSSSSSSSRLLLVDEQLMMKKGRGLNGSAYLNGILGVTTVEPNNMYTT
CIPIGGNYSSSGGVFAPTTLANASSDTLASGFEAAGYAAYSTALSVTIAIGCSLLILNVL
IFAGVYYQRDKTRLEVKTLQKQYQQRSLHQQVPYPPEPIKHAHYHMGHSQSSANVIVDVE
SHQDQAGQAAMLLQAAAAAAAAAANDVKPPPPHICSNTGMQQQQQVGGGSGGALNNGGIE
GSKVTTDNLGNVTYSTSSKQQQQHQQQQQQQQREHMQIKGMTGTQTFGRSGSGSGGGAGG
GAGSASGGASVVVSGSSVSYNPGMMTLPKSGGLHHAATLNYARNTTALNMSGGGTALVDS
RGNVLLTSTAVGPGMAGTGAGGGSSGGGGGGDCMTLPRNLGLAAAGRHNPTTELQQYQQQ
QQSSKHQSNGAVLTGMQSHHIRGPRPPLRTASSTTTNSSSNNSAMGVAVGVGGGVGNMLL
DQTPSGGSSSSGVSSAPSSSKGHHTHSHSHAAHLVHSHGDGLVLTSASPVGGQQQQHPQQ
HQHPQQQQQVPQAAMDEMRV
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaagtcagctgctgctgttgctgcggctcctgctgcttcctacagtcctcatt
tcctggatgcactgtgccggggcctccacggcggacatctacaagggcgctcgcctgggc
caccgtatcgttcagacgcgctatggccgacttcatggactcatcctgcccctggatagc
tttcgcttcctgcgatccgtagaggtcttcctgggtgtgccatatgcaacgcctcccacc
aaacaaaatcggtttagtcccacgagagctccagcgccttgggacggcatccggatatcg
gataaatacagtcccgtgtgtccgcagcgtttgcccaatatccaaaatgagacggcggcg
ctggagaagatgcccaagggtcgcctggagtacttaaagagattgctgccatttcttgaa
aaccagtccgaggactgcctgtacctaaatgtgttctcgccggtcaatgccggggccaat
gagaagaagttgccggtgattgtgttcatacacggcgagtccttcgagtggagcagcgga
aatccttacgacggcagtgtcctggcgagctacggggaagttgtggtggtaacactcaac
taccgactcggaatattaggtttcctcaacgccaatcccaatccacatgcccatgccaga
gtggccaactacgggctgatggaccagatggctgccctgcattggattcagcagaatatc
caaaagtttggcggagatcccaattcggtgacgttggcgggtcatggaacgggtgcagcc
tgtattaattacctaatgacctcgcctacaatggtccgtggtctcttccaccgggctatt
ctcatgtccggatcagcgtactcatcgtgggctttggtcgaggatccagtactatttgcc
atcaagctggccaaggaggttaactgcaccattcccgatgatatcaatcgccaccacgag
cagattgtcgattgtctgagggatgttcccctggaagacctttacctagccgacattcag
gctccaaattttctcacatccttcgggccttcggttgatggcgttgtcatacgacccggg
cattccaatctcgatatcgatgatttaatggcgcgcaactcgaggcgctcgtcagcggac
tccggtttccagtcgtccgccggaggtggtggcgggcaaggaggcggggccggtggcgga
ggaggcggtggctccggatcgtcgttcggcggtggatatttcggcggcagcggggccgga
acgatgaatatgggcggtcactatgacgtcctgtttggcgtcgttacgggcgaatcgatt
tggcgcttcagtgcccacgatatacaaaatggtttcgagggcgagagacgcgataaaatt
atccgcacctacgtccgcaacgcctacaattatcacctcaacgagattttctatacgatc
gtcaacgagtacacggattgggatcgcacctcgcagcatccgatcaatacccgcgatacg
gctgtagccgccctatccgatgcccagtttgtggcaccgattgtgcgggctggtgatatc
ctggcggccaattccccgccgccggtcagctcatcctcgaccgctgggtcgccgggtgca
aatgcggctgcttcgacctcagcgggctccactcagccctccggtcggtgctacttttac
gtgttcgattaccagacaaaggacggcgactatccacagagaatgggcactgtgcacggc
gaggacttgccctacattttcggcgccccactggtcgacggctttagtcactttccgcaa
aactacaccaaatcggagacggctctttccgaggcggtgatgatattctggaccaacttt
gctcgcaccggcaatcccaatgaacaccatcgccaggactcgtcgctgccggtttcaaag
gagcgcaaccgctttcgcagcatcacctgggaaaattatgatccgctgcaccagaagtat
ttggaaataggaatgaagccgcgcattaagaatcactttcgggcccatcaactctcgatt
tggctgcgcctgataccggagcttcatcgcgccgggatggaggatgtgatagcccggcac
aatctgttccgcaatcacgacgatatggacctgtacgagggacccgttaaaccggatccg
tttggcatatcgacagccgccggagcaagtggctcctcatcctcgtcgtcgtcctcatcc
cgccttctgctcgtcgatgagcaattgatgatgaagaagggacgcggcctgaacggctcg
gcctatttgaacggcatattgggcgtgaccaccgtggagccgaacaacatgtacacgacc
tgcatacccattgggggaaactactcgagcagcggtggtgtcttcgcacccaccactctg
gccaacgcctcctcggacactctggcctccggattcgaggcagccggctatgcggcctat
tcgacggccctgagtgttacgattgccattggctgcagcctgctcatactgaacgtgttg
attttcgccggagtctactatcagcgcgacaagacgcggctggaggtgaagacactgcag
aagcagtaccagcagcgtagcctgcaccagcaggtcccctacccaccggagcccatcaag
cacgcccactaccacatgggtcactcgcagagctcggccaatgtcatcgtcgatgtggag
agccatcaggaccaggccggccaggcggccatgttgctccaagccgcagcagcagccgca
gcagcagcggccaacgacgtgaagccaccgccaccgcacatctgctcaaacacaggaatg
caacagcagcagcaagtgggtggtggcagcggtggtgccctgaataatggtggcatcgag
gggtccaaggtgaccacagacaacctgggcaacgtcacctacagcactagctccaagcag
cagcagcaacaccagcaacaacagcagcagcagcagcgtgagcacatgcaaatcaaggga
atgaccggcacgcaaacattcggacgaagtggctccggatcgggaggcggggctgggggc
ggagccggttccgcttccggtggcgcctccgtggtggtgtccggcagcagcgttagctac
aatcccggcatgatgacgctgcccaagtcgggcggtctccatcatgcggccactttgaat
tatgcgcgcaacacgaccgccttgaatatgtcgggcggcggcaccgccctagtggatagt
cgcggcaatgtcctgctcaccagcaccgcagtgggtcctggcatggccggtactggtgct
ggaggaggatcctctggtggcggcggaggcggagattgcatgaccctgccacgcaatctt
ggtctggcggccgcaggacgacacaatcccactacagagctgcagcaatatcagcagcaa
cagcagtcgagcaaacatcagtcgaatggagctgtcctcactggcatgcagtcgcatcac
atacgcggaccacgcccaccgctccgcaccgcctcctcgacgacaacgaacagcagcagc
aataactcggcaatgggcgtggccgtgggcgtaggcgggggcgttggtaacatgctcctg
gaccaaacgccatccggcggcagcagcagcagcggcgtaagcagcgcacccagctcctca
aagggtcaccacacccactcgcactcccatgccgcccacctggtgcactcgcacggcgac
ggcctcgtcctgacctccgcctcgcccgtgggcggccagcaacagcagcacccgcagcag
catcagcatccgcagcagcagcagcaagtgccgcaggcggcgatggacgagatgcgcgtc
tga

DBGET integrated database retrieval system