KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3431Help
Entry
Dmel_CG3431       CDS       T00030                                 

Gene name
Uch-L5
Definition
Ubiquitin carboxy-terminal hydrolase L5 ortholog (EC:3.4.19.-)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG3431 (Uch-L5)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dmel_CG3431 (Uch-L5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67B9-67B9
AA seq 324 aa AA seqDB search
MGDGAGNWCLIESDPGVFTELIREFGCDGAQVEEIWSLDSESFKNLEPIHGLIFLFKWVQ
EDEPAGKVVLDRENIFFAKQVINNACATQAILSLLMNLDHEDIKLGETLTNFKEFCQCFD
PYNKGLTLSNASQIRTVHNSFARPTLFELDTKNQKKDDDVYHFVGYMPIGGRLYELDGLR
EGPIDLGEIKSEQNWIDVVRPIIEKRMQRYSDGEIHFNLMALISDRQRIYEQQIEKLLNP
APNAMDTEEDRQAEISSLRTYIEYEIQKKKRYKVENVRRKHNYLPFIVELLKILGENGQL
MPIYEKAKQRALEREQAQRKKDTD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacggtgctggaaattggtgtctcattgaatccgatcccggggtattcacagag
cttattcgcgaattcggatgcgatggggcacaggtggaggagatctggagtctcgacagc
gagtccttcaagaacctagagcccatccatggtctgatcttcctgttcaagtgggtgcag
gaggatgaacccgctggaaaagtggtcctggatcgggagaacatcttctttgccaagcag
gtgatcaacaacgcatgcgccacccaggcgatcttgagcctcctgatgaacctggatcat
gaggacatcaaattgggcgagaccctcaccaattttaaggagttctgccagtgcttcgat
ccgtacaacaagggattaactttgagcaacgctagccagattcgcacggtgcacaactcc
tttgctcgcccaacactcttcgagctggacactaagaaccagaagaaggacgatgacgtg
taccactttgtcggctatatgcccatcggaggaagactgtacgagctggacggcctgagg
gagggacccattgatcttggtgagatcaagtcggagcagaactggatcgatgtggtgcgt
ccgattattgagaagcgcatgcagcgctacagcgacggcgagatccacttcaatctgatg
gctctgatctcggacaggcagcgcatttatgaacagcagattgagaagctgcttaatccg
gcgcccaatgctatggacactgaggaggatcgacaggcggagatcagtagcttgcgcacg
tacatagagtacgagattcagaaaaagaagcgctacaaagtggagaatgtgcggcgcaag
cacaactatttgcccttcatcgtggagctcttaaaaattctgggcgagaacggacaacta
atgcccatctacgagaaggccaagcagagggcgctagaacgcgagcaggcgcagcgcaaa
aaggataccgactaa

DBGET integrated database retrieval system