KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3481Help
Entry
Dmel_CG3481       CDS       T00030                                 

Gene name
Adh
Definition
Alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dmel_CG3481 (Adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG3481 (Adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Dmel_CG3481 (Adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dmel_CG3481 (Adh)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG3481 (Adh)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG3481 (Adh)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG3481 (Adh)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dmel_CG3481 (Adh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:35B3-35B3; 2L:2-50.1 cM
AA seq 256 aa AA seqDB search
MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVT
FYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAI
LDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT
VNPGITRTTLVHTFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDL
GTLEAIQWTKHWDSGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttactttgaccaacaagaacgtgattttcgttgccggtctgggaggcattggt
ctggacaccagcaaggagctgctcaagcgcgatctgaagaacctggtgatcctcgaccgc
attgagaacccggctgccattgccgagctgaaggcaatcaatccaaaggtgaccgtcacc
ttctacccctatgatgtgaccgtgcccattgccgagaccaccaagctgctgaagaccatc
ttcgcccagctgaagaccgtcgatgtcctgatcaacggagctggtatcctggacgatcac
cagatcgagcgcaccattgccgtcaactacactggcctggtcaacaccacgacggccatt
ctggacttctgggacaagcgcaagggcggtcccggtggtatcatctgcaacattggatcc
gtcactggattcaatgccatctaccaggtgcccgtctactccggcaccaaggccgccgtg
gtcaacttcaccagctccctggcgaaactggcccccattaccggcgtgacggcttacact
gtgaaccccggcatcacccgcaccaccctggtgcacacgttcaactcctggttggatgtt
gagcctcaggttgccgagaagctcctggctcatcccacccagccctcgttggcctgcgcc
gagaacttcgtcaaggctatcgagctgaaccagaacggagccatctggaaactggacttg
ggcaccctggaggccatccagtggaccaagcactgggactccggcatctaa

DBGET integrated database retrieval system