KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3481Help
Entry
Dmel_CG3481       CDS       T00030                                 

Gene name
Adh
Definition
Alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:dme01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dme00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:dme00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dme00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:dme00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:dme00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:dme00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
2L:35B3-35B3; 2L:2-50.1 cM
AA seq 256 aa AA seqDB search
MSFTLTNKNVIFVAGLGGIGLDTSKELLKRDLKNLVILDRIENPAAIAELKAINPKVTVT
FYPYDVTVPIAETTKLLKTIFAQLKTVDVLINGAGILDDHQIERTIAVNYTGLVNTTTAI
LDFWDKRKGGPGGIICNIGSVTGFNAIYQVPVYSGTKAAVVNFTSSLAKLAPITGVTAYT
VNPGITRTTLVHTFNSWLDVEPQVAEKLLAHPTQPSLACAENFVKAIELNQNGAIWKLDL
GTLEAIQWTKHWDSGI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttactttgaccaacaagaacgtgattttcgttgccggtctgggaggcattggt
ctggacaccagcaaggagctgctcaagcgcgatctgaagaacctggtgatcctcgaccgc
attgagaacccggctgccattgccgagctgaaggcaatcaatccaaaggtgaccgtcacc
ttctacccctatgatgtgaccgtgcccattgccgagaccaccaagctgctgaagaccatc
ttcgcccagctgaagaccgtcgatgtcctgatcaacggagctggtatcctggacgatcac
cagatcgagcgcaccattgccgtcaactacactggcctggtcaacaccacgacggccatt
ctggacttctgggacaagcgcaagggcggtcccggtggtatcatctgcaacattggatcc
gtcactggattcaatgccatctaccaggtgcccgtctactccggcaccaaggccgccgtg
gtcaacttcaccagctccctggcgaaactggcccccattaccggcgtgacggcttacact
gtgaaccccggcatcacccgcaccaccctggtgcacacgttcaactcctggttggatgtt
gagcctcaggttgccgagaagctcctggctcatcccacccagccctcgttggcctgcgcc
gagaacttcgtcaaggctatcgagctgaaccagaacggagccatctggaaactggacttg
ggcaccctggaggccatccagtggaccaagcactgggactccggcatctaa

DBGET integrated database retrieval system