KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3781Help
Entry
Dmel_CG3781       CDS       T00030                                 

Definition
(RefSeq) CG3781
  KO
K15235  josephin [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG3781
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C86
   Dmel_CG3781
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    Dmel_CG3781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Josephin
Motif
Other DBs
NCBI-GeneID: 31560
NCBI-ProteinID: NP_572303
FlyBase: FBgn0029853
UniProt: Q9W422 C4XVM0
Position
X
AA seq 221 aa AA seqDB search
MESPSARTLGNSLGDDSGNGNENGNGSGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQG
PDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPH
CLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQ
QFLEFLATQLQMDHELFLVLDEETDCKDKSQQRWLLPQFRD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcccagtgcccgaactctcgggaattccctgggcgatgacagcggcaacggg
aatgaaaacgggaatggaagtggaaacggaaacaccacaatgatgccgcatggaatctac
catgagcggcagacacgtcacctgtgcggcctccacgcactgaacaatctgttccagggg
cccgacatgttctccaaatcggaactggacgactactgcaccacattgaccccgcgcaac
tggctgaatccgcatcgatcgtggatcggttggggcaactacgacgtcaatgtgatcatg
tacgccctgcagcagcggaattgcgaggcggtgtggtttgatcgacggcgggatccacac
tgtctcaatctgagcgtcattttcggcttcattctcaatgtaccggctcagatgagcctg
ggctactacatcccactgcccttccacatgcgacactggctggcactgcgtcgcttgaac
ggcagctactacaatctggactccaagctgcgcgagcccaagtgcctgggcaccgagcag
cagttcctcgagtttctggccacccaactgcagatggatcacgagctattcctcgtgttg
gacgaggagacggactgcaaggataagagccagcaacgttggctgctaccgcagttcagg
gattaa

DBGET integrated database retrieval system