KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3781Help
Entry
Dmel_CG3781       CDS       T00030                                 

Definition
CG3781 gene product from transcript CG3781-RA (EC:3.4.19.-)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG3781
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C86
   Dmel_CG3781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:5E3-5E3
AA seq 221 aa AA seqDB search
MESPSARTLGNSLGDDSGNGNENGNGSGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQG
PDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPH
CLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQ
QFLEFLATQLQMDHELFLVLDEETDCKDKSQQRWLLPQFRD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgcccagtgcccgaactctcgggaattccctgggcgatgacagcggcaacggg
aatgaaaacgggaatggaagtggaaacggaaacaccacaatgatgccgcatggaatctac
catgagcggcagacacgtcacctgtgcggcctccacgcactgaacaatctgttccagggg
cccgacatgttctccaaatcggaactggacgactactgcaccacattgaccccgcgcaac
tggctgaatccgcatcgatcgtggatcggttggggcaactacgacgtcaatgtgatcatg
tacgccctgcagcagcggaattgcgaggcggtgtggtttgatcgacggcgggatccacac
tgtctcaatctgagcgtcattttcggcttcattctcaatgtaccggctcagatgagcctg
ggctactacatcccactgcccttccacatgcgacactggctggcactgcgtcgcttgaac
ggcagctactacaatctggactccaagctgcgcgagcccaagtgcctgggcaccgagcag
cagttcctcgagtttctggccacccaactgcagatggatcacgagctattcctcgtgttg
gacgaggagacggactgcaaggataagagccagcaacgttggctgctaccgcagttcagg
gattaa

DBGET integrated database retrieval system