KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3797Help
Entry
Dmel_CG3797       CDS       T00030                                 

Definition
CG3797 gene product from transcript CG3797-RB (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG3797
   00053 Ascorbate and aldarate metabolism
    Dmel_CG3797
   00500 Starch and sucrose metabolism
    Dmel_CG3797
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG3797
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG3797
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG3797
   00982 Drug metabolism - cytochrome P450
    Dmel_CG3797
   00983 Drug metabolism - other enzymes
    Dmel_CG3797
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG3797
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG3797
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:75F6-75F6
AA seq 636 aa AA seqDB search
MQILQVFLGTLLCGIVLGANVLTVFPSVWKSHYLFGRRLLQELVESSGNHSVTLISPHAA
QEGVDAEIPKIRELRIEGLRENWLDMGMSFEAEEMRAQSVMERFTRLIYAGTTNVDILLS
DPQVRKLLTSGEKFDLLIVDLFLSDALLGLAFYYGIPTVAVSPTGANSWLNNMFGNPQSS
SLDPSNFLPFTERMNTRQRILNSLMSTFERLTYNFFHLISQQSVYTNHFELLVKELPLYR
DLTKNLSLALINSHPGLHYPRAYLPNMVEVGGLHLSHLNDDNLPKHLLSFMESAPSGVIY
FSLGADVETAQLPQEKLAIILDVFGHLKEFHFLLKWEKEEFTAEQVLPENVMIADWWPQQ
AILHHPQVKMFISSCGQLSVWESISGQKPVLAIPILAEQEVMAKRLQRHGVSVTVGYDSL
AYDSLLHGIRQLTLNTSYVEKLGQLKERLISRDSTPVGKAVRKIQLILESGGADFLKSHA
NTLNFWRAEGVDVLLIIAVGFFGILTIPFLAICFILRKSYHSQAAQDQPPYRTNLKVVGR
VHSYGDQGSSRSPKGTESLRRTRSAQSLSARSSSSSMSSNSPTSPSTASTTPLDLTPPPP
IQLLGQVPPLQLYVNQQRIYSSDRKTSQEEAERRFS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcctgcaagtgtttctgggcacgctgctctgcggcatcgtcctgggcgccaat
gtactgacagtttttcccagtgtctggaaatcccactatctctttggccggagattgctt
caggagctggtggagagttcgggcaaccactccgtaactctgatcagtccacatgccgcg
caggaaggtgtggatgcggaaatacccaaaatcagggagctgcgcatcgaagggctgcgg
gaaaactggctcgacatgggcatgagttttgaggccgaggaaatgcgggcccagagtgtg
atggaaaggttcacccggctgatctacgctggcaccaccaatgtggacattttgctgtcg
gatccccaggtccggaagctcctgaccagcggcgaaaagttcgacttactcatagtggac
ctgttcttaagcgatgctctgctaggcttggccttctactatggcatacccaccgttgca
gtcagtcccactggcgcgaattcctggctgaataacatgtttggcaatccgcaatcgtcc
tcactggatcccagcaatttcctgcccttcacggagagaatgaacacgaggcagaggatt
ctaaactcgcttatgagcacctttgagcgcttgacctacaactttttccacttgatctcc
cagcaatccgtgtacacaaatcacttcgaactgctcgttaaggagctgccgctttataga
gatctgacaaagaatctcagtttggccttgattaactcgcatccaggcctacattatccc
cgtgcatatttgcccaacatggtggaagtgggcggcctgcacttaagccacttaaatgat
gacaatttgccaaaacatcttctgtcgttcatggaatcggctcccagtggggttatctat
tttagcctgggcgccgatgtggaaacagctcaactgcctcaggaaaagttggccattatt
ctggatgtgtttggccacctcaaggagtttcacttcttgctgaagtgggaaaaggaggag
tttacggcggaacaggtgctgccagagaacgttatgattgctgactggtggccacaacag
gccatccttcaccatccgcaggtcaagatgtttattagcagctgcggtcagttgagcgtt
tgggaatcgattagtggacaaaagccagtacttgccatacccattctagccgaacaagag
gtgatggctaagcgcttgcagcgacatggagtctccgtgaccgttggctacgactcgtta
gcttacgattcgctgctccacggcataagacagctcaccctgaataccagctatgtggag
aagttgggtcaactcaaagaacgactgattagccgcgattccacgccagttggaaaagct
gtgcgaaagatacagcttatattggagtctggaggagctgactttcttaagtcgcacgcc
aataccttaaacttttggagagctgaaggtgtggatgttctgcttataatagcagtgggc
ttttttggaattttaaccattcctttcctggccatttgctttatactaagaaaatcctac
cacagccaagccgcgcaggatcagccaccatacagaaccaacctgaaagtggttggcaga
gtgcacagctatggtgaccaggggagtagtagatctcccaagggaacagagtcgctcaga
agaacgcgatccgctcaatctttatcggcgcggtccagctcttcgagcatgagctccaat
tcaccgacgagtccatcgacagcgtccactacgccactggacctaactcccccacctccg
attcagctgctcgggcaggtgccgcccttgcagttgtacgtgaatcagcagcggatatac
tcaagcgatcgaaagacatcacaggaggaagcagaacgcaggttctcataa

DBGET integrated database retrieval system