KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3886Help
Entry
Dmel_CG3886       CDS       T00030                                 

Gene name
Psc
Definition
(RefSeq) posterior sex combs, isoform B
  KO
K11459  
polycomb group RING finger protein 4
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Chromosome [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     Dmel_CG3886 (Psc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
2R
AA seq 1601 aa AA seqDB search
MMTPESKAIQPAAATTKQTAEATATTTMAHTQQKSQLSTLAKTTTTTATNKAAKSVVSNA
NSSGNNSSKKLALSQSQKTTTTTTPPTTTTTTTAAAAAEATTNADKMQKQQQLKQQLFAA
CSIKVKSENTLATTANAALAAATTTTTTATPALATGKAAKTILENGIKKESTPPAVESVE
ASSSSSSSSSSSSSSSSSWPTTRRATSEDASSNGGASADEEKSEEDPTAAVAASSTATTT
SDLATTSRPRPVLLTAVNPHIICHLCQGYLINATTIVECLHSFCHSCLINHLRKERFCPR
CEMVINNAKPNIKSDTTLQAIVYKLVPGLYERELMRKRAFYKDRPEEAALATPEQRGDDT
EHLIFSPSDDMSLSLEYAELGELKTDSEPELVDTLRPRYLQCPAMCRVSHLKKFVYDKFE
IDAQRFSIDIMYKVKTIVLLDYYTLMDIAYIYTWKRDAPMRFYYRVYESPQPLVKPAPRR
VLPLKLEKQERENQEQQLAVEVASSKVEPVSLPEDQKAEASIKVEEQESTREIVKEVIKD
VAATPPTETLKLVINRNMLDKREKSHSPQMSSKSSSKSSPCTPVSSPSEPNIKLKIDLSK
QNSVTIIDMSDPERREIVKPLKPEKESRSKKKDKDGSPKSSSSSSSSSSGERKRKSPSPL
TVPPLTIRTERIMSPSGVSTLSPRVTSGAFSEDPKSEFLKSFALKPIKVKVESPERTLNN
RAITPPSPSVQQSASPKSKGNNLDDSILMKPPSCMPPKSIASSKRKSKEPVKAVSKKQKL
SPPLPTVDFKIRLPVTNGNSSGTASPKIEKPLMPPPAKPPMLAPRKLQPSAQFAPPPSPI
HHHAGVQMSAPGNRTPIAKRYQPILPKASRPNPFANIPNDVNRLLKDAGTEIKSIGGGSV
ENNSNAAQKPHLYGPKGESKMGPPALPATTPSQGNKNVGKQAGNLPMSAPPNKGNSSNNY
LNLALFNSSKCKGKEAPPGCRTPMYTPNSPIYSPSSPQYVPSYNIPTMPTYKYTPKPTPN
SGSGNGGSGSYLQNMLGGGNGGSLGGLFPSPPTKSDQNTNPAQGGGGSSSATQSGGNNGI
VNNNIYMPNEDAPEKQQVKVKSLLNSCNINIPSSLSITISRDNGDSSSPNNGQHPKHKSP
VNNYIEIVKLPDQPQDQVQAAKEAQKRQSPPAAVPGHLAAKLPPPPPSKAIPSPQHLVSR
MTPPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTPLKPVLTPTQVDKKTPSPEKRTAA
QMGSHSPTASENKSPKGGPAGVANSTGGAQNGDPAAKKFRPILPRQNGMPELAPKLPTLA
PFVGFNPLQNPAAGKKVPPSKKSPNAGAAAHQSGQQKLVNGGQSQPAQQKTSPPAQKNQQ
QVKKVSKNPTPPPPSLPAVGKMMPHPVMHSQNAPLSIASSASAAAVASGQLDLSNFLKEN
LRRVHAAQAAQAAQVAAAANQSNMMYNLAQMGHMTPAMYNYQQAYFREQLSRMQRVGNEV
FNDYLQKLKTAAATGGGGPVEGELKPMLPTVTLPSPGATPPAASPKTSPLPAGKLTAAAT
APQTKGNSSSGAANARQQTAATGNNGATVPAASLPPATKSK
NT seq 4806 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgccagaatcgaaagcaatacagccggcagcagcaacaacaaagcaaacagca
gaagcaacagcaacaacaacaatggctcacacacaacaaaagtcgcagttgtcaacgttg
gcgaaaacaacaacgacaacggcaacgaataaggcggccaaaagcgttgtcagcaatgca
aatagcagtggcaacaattcgagcaaaaagctggctttgtctcagtctcagaaaacaaca
acaacaacaacaccaccaacgacgacgacaacaacaacagcagcagcagcagcagaggca
acaactaatgctgataaaatgcaaaagcaacagcaactgaagcagcaacttttcgctgcc
tgcagcattaaagtaaaaagtgaaaacacattagcaactactgcgaatgcagcattagca
gcagcaacaaccacaacaacaacagcaacaccagcacttgccaccggcaaagcagcaaaa
acaatattagaaaacggcataaagaaggaatccacgcctccggctgtcgaatccgttgag
gcctcctcctcatcgtcatcctcctcctcgtcctcctcatcatcatcgtcctcgtggccg
acgacaaggagagccacttcagaggacgccagcagcaatggtggcgcctccgccgacgag
gagaagtcggaggaggacccaacggcagctgtggctgcgtcttcaacggcgacaacgact
tccgatttggccacaacttcaaggccacgccccgtccttctaacggccgtcaatccgcac
atcatctgtcacctgtgccagggatatctgatcaatgccaccaccatcgtcgagtgtctg
cactccttctgccacagttgcctcattaatcacctgcgaaaggagcgattctgcccgcgc
tgcgagatggtcatcaacaacgccaagccgaacatcaaatcggacaccacgctccaggcg
atagtgtacaagctcgtgccgggcctttacgaacgggaactgatgcgcaaaagggccttc
tacaaggatcgtcccgaggaggcagctttggccacgcccgagcaacgaggcgatgatacg
gagcatctgatctttagtccctcggatgatatgtctttgtcgctagaatatgccgaattg
ggggaactgaaaaccgattccgagcctgagttggtggacacactgcgtccgcggtacctt
caatgcccggccatgtgccgtgtgagccacttgaagaagttcgtctacgacaaatttgag
attgatgcccagcgttttagtatcgacattatgtacaaggtcaagacaatcgttctgctt
gactactacacgctaatggacattgcctacatctacacgtggaaacgggatgcacccatg
cggttttactaccgtgtttatgagtcgccccagccgctggtgaagccggctcctcgtcga
gtgctgccactaaagctggagaagcaggagagggagaatcaagagcaacagctggcagtt
gaagtcgcgtcttcgaaggtggaacctgtgtccctgcccgaggaccaaaaagccgaagct
tccattaaagtggaggagcaggagagcactagagaaattgtgaaagaagtgatcaaagat
gtggcagccacacccccgacagagacactgaagctggtgatcaaccgaaatatgctggac
aagcgtgaaaagagtcactctccacagatgagctccaaatcgtcgtcgaaaagttctccc
tgcactcccgtttcgtcaccctcggagcccaatatcaagctgaaaatcgatctgtccaag
cagaacagtgtcaccattatcgatatgtccgatcccgagcgcagagagattgttaaaccc
ctaaagcccgagaaggagtcacgttcgaagaagaaggacaaggacggaagtcccaaatcg
tcgagcagctccagttcctcttcaagtggagagcgcaagcgtaagagtcccagcccgttg
acggttcctccattgaccattcgcacagagcgcatcatgagtccaagcggcgtgagcacc
ctgagtccaagagtaaccagcggagctttctcggaggatcccaagtcggagttcctcaag
tcgtttgcactgaaacccatcaaggtgaaagttgaatcaccggaaaggacgttaaacaac
agagccatcaccccgccttcgccttcagtgcaacagtccgcttcacccaaatcgaagggt
aacaacctggacgacagtattcttatgaaaccgcccagctgcatgcctcccaaatccatt
gcatcttcgaagagaaagagcaaagaaccagttaaggcggtgtccaagaagcaaaaacta
tcgccgccccttccaacggtggactttaagatacgcctgcccgtcaccaatggcaattct
tcaggcactgcatctccaaagatagaaaaaccgctgatgccaccgccggcaaagccgcca
atgttggctccccggaaactccagccctccgctcagtttgcgccgcctccatcgccgata
catcatcatgccggtgtgcagatgtcagctcctggtaatcgaacacccatcgccaaacgc
tatcagccaattttacccaaagcttcgcgaccaaatccctttgccaatataccaaacgat
gtgaatcgattgctcaaagatgctggtaccgaaatcaagtcgattggtggaggatcagtg
gagaacaacagtaacgctgcccaaaagccacatctgtacggacccaagggagaaagtaag
atgggacccccggccttacctgcaaccaccccatctcagggtaacaaaaacgttggaaag
caggcaggcaatttgccgatgtcagcgccgcccaataagggtaacagttcgaacaactat
ctgaatctggcgctgttcaattccagtaagtgcaagggcaaggaggcgcctcctggctgc
cgcactcccatgtacacgccaaattcgccgatatactcgcccagttcgccgcagtatgtg
cccagctacaatattccaacaatgcccacctataagtatacaccgaaaccaactccaaat
tctggtagtggtaacggaggctctgggagctatctgcagaatatgttgggaggcggaaat
ggtggatctcttggcggattattcccctcaccgcccaccaagtcggatcagaatactaat
ccagctcaaggaggaggaggttcatcttcagctactcaaagtggaggtaataatggcatt
gtgaataacaatatctatatgcccaatgaagatgcgcccgaaaagcagcaggtgaaggtc
aagtctctgctcaactcgtgcaacatcaatattccctcctcgctatcgatcaccatctct
cgggataatggagattcttcatcacccaataacggacagcatcctaagcacaaaagtccg
gtcaacaattacattgagattgttaagctgcccgatcagccgcaggatcaggtccaggct
gccaaggaggctcagaaacggcagtcaccacctgctgccgttccaggacatctagccgca
aagttgcccccgccgccaccatccaaagctattccttcgccgcagcatttggtgtcgcgt
atgacgccgccacagttacccaaagtggccactccaccgcctccaagttctcctcgcgtg
atcacgccaccaaaaacatcaccacctgccaatgccgcaaaggtaacgcctttgaagcca
gtgctcacgccaacgcaggtggataagaagacacccagcccggagaagcgaaccgccgcc
cagatgggcagtcattcaccaactgccagtgaaaacaagtcgcccaagggcggacctgca
ggagtggcaaattcgactggtggcgctcagaatggcgatccagcggccaagaagttccga
cccattctgccccgccagaatggcatgcctgagttggcacccaagctgccaacactggcg
cccttcgttggtttcaacccactgcaaaatccagccgctggcaagaaggtgccgcccagc
aagaagtcaccgaatgccggagcagctgcccaccagagcggccaacaaaagctggtcaat
ggtggacagtcgcagccggctcaacagaaaactagcccaccagcccagaagaatcaacag
caggtgaagaaggtgtccaagaatccgactccaccgccaccatccttgccggcagtcggc
aaaatgatgccccatcccgtcatgcacagtcagaatgctccactaagcatcgcctccagc
gccagtgctgcggcagtcgcctccgggcaattggacctgagcaacttcctcaaggagaac
ctgaggcgggtgcatgccgcgcaagcggcgcaggctgcccaggtggcggccgctgccaac
cagtcgaatatgatgtacaatctggcccaaatgggtcacatgacgccagcgatgtacaac
taccagcaggcatatttcagggagcagttgtcgcggatgcagcgcgtcggaaacgaggtt
ttcaacgattacctgcaaaagctgaagactgcagcagcgaccggaggaggtggtccggta
gaaggagagcttaagcccatgctgcccaccgtcacgttgcccagtccaggagctactccg
ccggcagccagtccgaaaacatcacccctgccagctggaaaactcacggcagcagctacg
gcaccccaaaccaagggaaacagcagcagtggagcggctaatgcacggcagcagacggcg
gccaccggcaacaacggagcaacagtgcccgccgcctccttgccaccggccaccaaaagc
aagtga

DBGET integrated database retrieval system