KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3937Help
Entry
Dmel_CG3937       CDS       T00030                                 

Gene name
cher
Definition
(RefSeq) cheerio, isoform A
  KO
K04437  
filamin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dmel_CG3937 (cher)
  Intermediate filaments
   Intermediate filament-binding proteins
    Dmel_CG3937 (cher)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG3937 (cher)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 2210 aa AA seqDB search
MEAERDLAEDAQWKKIQQNTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKR
MPKYNKRPTFRSQKLENVSVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYS
ISMPMWDGEDDKQLNGSGHTPKQRLLNWIHAKIPDLPINNFTNDWTTGKAVGALVDACAP
GLCPDWELWDPKDAVQNASEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNS
KLKTGAPLRPKTNPNRVRAYGPGIEPIGPVVGAPANFTVETFSAGKGSVDVDIQGPNGEI
EKADVRFNNDKNLTYTVSYIPKSEGSHKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVT
GPGIQPNGVTIKKPTFFDILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLENDTWRCEYV
TALQGLHSVNVFYAGTPIPNSPFPVKVAPLSDARKVRASGRGLQATGVRVGDDADFKIYT
EGAGEGEPEVRVIGPGGMNQNVMQSKVDGNTYECHYYPTKEGRYVIMVTFAGQEVAKSPF
EVKVGPKKESSIVAYGPGLSSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGD
GSALVKYHPTAVGEYAVHILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLEKNGVTI
NQPTSFTVDPSKAGNAPLDVVVQDVFGTKLPVELKNNPDGTKKVTYTPTSGVPHTVEVNY
GGVSTPNSPHRVYVGVPVDAAKVQAFGPWLQPGVRPNAATHFNVDAREAGDAELKVKIIH
EETKIEVPCRIIDNEDNTYSVEVIPPSKGAYTTTMTYGGQRVPLGEKVVVEQTVDVSKIK
VDGLEPSVIMNAATDFMVDMSKVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIM
YTPFEAGRHTIELMYDNIPVPGSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVET
KGAGNGGLSLAIEGPSEAKMTCTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRV
LVEETVDPSKVKVYGPGIEHGQVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRV
EDKGNCIYAVHYVPPKAGSVLTCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKK
TPASLPAEFEIDTKQAGQADINVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCS
IKYGDKEIEGSPFKLEAFPTGEAKKCKLVEQAPKIQTSGSQSHLKVDAREAGDGAVTCKI
TNKAGSEIVDIDVIEKDGFFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYS
HSEYIEEHTTKVVQQTTQSELVNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDK
PVIQDNRDGTVSVKYDPREEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTH
GVTGEPANFTISTKGASAGGLTMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVR
FGDKHIKGSPYFAKITGEGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEP
CFLKRMPTGNIGISFTPREIGEHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGTG
LKEGQTHADNIFSVDTRNAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIV
NLKFADHHVEGSPFTVKVAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDL
AACVTSPSNVTEDAEIQEVEDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLR
DSGSHLVKAGGSGLERGVVGEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCD
VSYKVTEPGEYRVGLKFNDRHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFM
VRKNGAKGELDAKIVAPSGTDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDS
PFRIKVGKDVADPAAVHASGNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDC
TEVEEGYKVRYTPLLPGEHYITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETV
QKVAKGGKNTGVHLPTFKSDASKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYG
PKGPCEEFHVKHAGHNNYNVQYLVRDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 6633 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgaacgcgatctcgccgaggatgcgcagtggaagaagatccaacagaacacc
ttcacccggtgggccaacgagcacctgaagaccatcgatcggtcgatcaacaacctggag
acggacctgtccgacggcctccgactgatcgccctgatcgaagtgctgtcccagaagcga
atgcccaaatacaacaaacgcccaacattccgcagccagaaactggaaaacgtctcggtg
gccctgaaattccttcaggatgagggtatcaaaatcgttaatattgactcgtcggacatt
gtggactgtaagctgaaactgatactgggtctgatatggacactgattctacactactcg
atatcgatgcccatgtgggatggcgaggacgacaagcagctcaacggctcgggccacact
cccaagcagcgcctgttgaactggatacacgccaagatacccgacttgcccatcaacaac
tttaccaacgactggaccacgggcaaggctgtgggcgcccttgtcgacgcctgtgctccg
ggtctctgtcccgattgggagctgtgggatcccaaggatgccgtgcagaacgcctccgag
gccatgggcctggccgatgactggctcaacgtgcgccagctgatcaagcccgaggagctg
gttaatcccaacgtggatgagcagtctatgatgacctatctgtctcagtaccccaactcc
aagctcaagactggagctcccttgaggcctaagacgaatcccaacagagtgcgtgcctat
ggtcctggtattgagcctattggtcctgtggtgggtgccccagccaattttaccgtcgaa
accttctctgctggcaaaggttctgtggacgttgacattcagggacccaatggagagatc
gagaaggctgatgtgcgcttcaacaatgacaagaatctcacgtatacagtttcgtacata
cccaaatccgagggttcgcacaaggtggccgttaagttctccggtcgcgacattcccaag
tcgccgttccccgtcaaggtggaaggtcatgctggtgacgcctctaaggtgaaagttacc
gggcccggaatacagcccaacggtgttaccatcaaaaagccaaccttcttcgatattctt
gccaaggatgctggtcgcggagtgcccgaagtgattatcatcgatccggctaaccacaag
acttctgtggccgccaaagtccgtcagctggaaaacgatacttggcgatgcgagtacgtg
accgctctgcagggattgcactcggtgaatgtcttctatgctggaacaccgatccccaac
agtccgttccctgtgaaggtggctccgttgtccgatgcgcgtaaagttcgcgcttctgga
cgtggtctccaggcaacgggcgttcgcgtcggggacgatgccgacttcaagatctatacc
gagggagccggcgagggtgagccagaggtgcgcgtcattggtcctggtggcatgaaccag
aacgtcatgcagtcgaaggtggatggcaatacctacgagtgccactactatcccaccaag
gaaggccgttacgtcatcatggtgacctttgctggccaagaagtggccaagtctccgttt
gaggtgaaggtgggtcccaagaaggagtcctcgattgtggcctatggacccggactgagc
agcggcgttatcggctacccagctgcttttgtagtggagaccaatggcgagactggcgcc
ctcggtttcaccgtggccggtccttcgcaggccgagatcgagtgccacgacaacggcgat
ggttctgccctggtcaagtatcatcccaccgctgtgggagagtacgccgtgcatatattg
tgtgacaatgaggacatccccaagtcgccgtttatcgctcagatccttccacgcaccgat
ttccatcccgagctggtcaaggctagtggtcctggactggaaaagaatggtgtgaccatt
aaccagccgaccagcttcaccgtggaccccagcaaggcaggaaatgctcccttggacgtt
gtcgttcaggatgtgttcggcaccaagttgcccgtggagctaaagaacaacccagatggg
accaagaaggtaacctatactcctacttctggagttccgcacaccgtcgaagttaactat
ggcggagtttctacgcccaattcaccccatcgtgtttacgtcggagttccggttgatgca
gccaaggtgcaggcctttggaccctggttgcagcctggagtgcgccccaatgcagccaca
cacttcaatgtggacgcccgtgaggctggagacgccgagctgaaggttaagatcattcat
gaggaaactaagatcgaggtaccgtgccgcatcatcgataacgaggacaacacctactcc
gtggaagtaattccgccttccaaaggtgcctacaccactacgatgacttatggtggccaa
agggttcccctgggcgagaaggtcgtcgtggaacaaacggtggatgtatctaagatcaag
gtggacggacttgagccaagtgtgatcatgaatgcggccacggacttcatggttgatatg
agcaaggtgggcagcaacatcgactcaggaaagctgtcctgtgcgatcttcgacccaatg
ggccatgtgttgccaagcaagattgtccaaggtccaaccgacgacatcttccgcatcatg
tacactccattcgaggctggccgccacaccattgaactgatgtacgacaacatcccagtg
ccaggatctccgtttgttgtgaatgtgaagagcggctgtgatcctgctcgctgcaaggcc
tacggaccaggcctcgaaaaaggactgaccaatcagaaaaacaaattcaccgtggaaacc
aagggtgcaggtaatggtggcctttcgcttgccatcgagggtccttcggaggcaaaaatg
acgtgcacggacaatcgcgacggtagctgcgacgttgactatttggccactgatccagga
gagtatgacattaccattcggtttgcggacaagcacatacccggctctccattccgcgtg
ctcgtcgaggagactgtggatcccagcaaggtgaaggtgtacggtccgggcatcgagcac
ggccaggtgcgcgaaagtgtgcccaccttcttcaacgtggatgtgggcgaggctggtcct
ggccgcattgccgttaagctgaccaactccgaaggtattcccgtggacaatctacgcgtg
gaagacaagggcaattgcatttacgcggttcactatgtgccgcccaaggctggctccgtg
ctcacctgccaggtgaagttctccgaggttgaagtgccatgcagtccatttgtgatgacc
gttttcccgaaatcagaacccaccaaggttaaggtaaagggtgtcaatgagaagaagaaa
acgcctgcttccctccccgcagagtttgaaatcgatacaaaacaagccggtcaggctgat
atcaatgtggccattaagaaccccaagggcaaggcgatgcagccgcgcctggaggaggtg
tccaccggcacgtacgtggtgtcctttgtgccagatgagtgtggcacctaccagtgcagc
atcaagtacggcgacaaggagatcgagggctcacccttcaaactcgaagcattccccacc
ggcgaagccaagaaatgcaaactggtggagcaggcgcccaagattcagacctcgggcagt
caatcgcacctaaaagtggatgctcgtgaggccggagatggagcggtgacctgcaagatc
accaataaggcgggcagcgaaattgtggacattgatgtgatcgaaaaggatggtttcttt
gacattctgtacgcccttaacgatcccggagattatgacatcaacgtaaagttcggcggc
aaggacataccgaacggcagcttctccatcaaggctgtcgaaagtatcgagcaatactcg
cattctgaatacatcgaggagcacacgaccaaagtggtgcagcaaactacgcagagcgag
cttgtcaacggaaaatctgagatcacctatcgcagtgtagcatttgagaaattaccacta
cccacaacaggcggcaacgttacagctgaagtcagaatgcctagcggtaaagtagacaaa
cccgtgatccaggacaaccgtgatggtaccgtctcggtgaagtacgatccccgtgaggag
ggatcccacgagctggtggtcaaatacaacggagaacccgtgcaaggatctcccttcaaa
ttccacgttgactcgatcacctccggctatgtgactgcctacggacccggcctgacccac
ggagtcaccggtgagccggccaactttaccatctccaccaagggagccagcgccggtggc
ctgaccatggccgtcgaaggacccagcaaggctgacatcaactaccatgacaacaaagac
ggcactgtatctgtgcaatacctgcccactgctcctggcgagtaccaggtgtccgttcgc
ttcggcgataagcacatcaagggatcgccgtacttcgccaagatcaccggcgagggtcgc
aagcgcaaccagatctcggttggctcctgctccgaagtgaccatgcccggcgacattacc
gatgacgatctgcgcgctttgaacgcctcgatccaggcgcccagtggcctggaggagccc
tgcttcctgaagcgcatgcccactggcaacattggcatctcgttcacgccccgcgagatt
ggcgagcatctggtgtcggtgaagcgtctgggcaagcacatcaacaactcaccatttaag
gtgactgtctgcgagcgcgaggtgggcgacgccaagaaggtcaaggttagcggaactggc
ctcaaggagggtcaaacccatgccgacaacatcttctccgtggacacgaggaacgccggc
ttcggtggtctttcggtctccattgagggtcccagcaaggctgagatccagtgcacggat
aaggatgacggtactctcaacatctcgtacaagcccactgagccgggctactacattgtt
aacctgaagttcgccgatcaccacgtggagggttctcctttcaccgtcaaggttgccggc
gagggcagcaaccgcaagcgcgagaagatccagcgggagcgcgatgctgttccaatcacg
gaaatcggaagccagtgcaagctgacattcaagatgccgggcattacctcgttcgatctg
gccgcctgtgtcacctcgcctagcaacgtgaccgaggatgcggagatccaagaggtggag
gatggcctctacgcagtgcactttgtgcccaaggagttgggcgtgcacacggtgtcggtg
cgctattccgagatgcacatacccggatcaccgttccagttcaccgtgggaccactgcgc
gactccggcagccatcttgttaaggctggaggctctggtctggagcgaggtgttgtcgga
gaggcggccgagttcaatgtgtggacccgcgaggcaggcggtggttccctggccatttcc
gtggaaggtcccagcaaggctgacatcgagtttaaggaccgcaaggacggcagctgcgat
gtgtcgtacaaggtcaccgaaccgggagagtaccgcgtgggcctgaaattcaacgatcgc
cacatacccgactcaccattcaaggtgtacgtctccccggatgcgggtgatgcccacaag
ctggaggttcagcagttcccgcagggtaacatccaggcggacgctccctaccaattcatg
gtccgcaagaacggtgccaagggtgagctggatgccaagattgtggctccatccggaacg
gacgatgattgcttcatccaggtgatcgacggcgagatgtactcggtgcgattctatcca
cgcgagaacggaatccatgccatccacgtcaagttcaacggcgtccacatacccgactct
ccattcaggatcaaggtgggcaaggatgtggccgatccagctgccgtgcacgccagcggc
aatggattggacgaagtgaagactggacacaaggccgacttcatcatcaacacctgcaac
gccggcgttggcacgttggccgtctccatcgatggaccctccaaggtggccatggactgc
acagaggttgaggagggctacaaggtccgctacaccccgctcctgcccggcgagcactac
atcacggtcaagtacaacaacatgcacatcgtgggctcgccattcaaggtgaacgctacc
ggcgacaagttagcggatgagggcgcccaggagacgtccacggtgatcgtggagaccgtg
cagaaggtggccaaaggaggcaagaacacgggcgtccatctgcccacctttaagtcggat
gccagcaaggtggtgtccaagggtatgggcctgaagaaggcctacattggcaagcagaac
cagttcagcatcagcgccaccgatgcgggcaacaacatcctgtacgtgggcatgtacgga
ccaaagggaccctgcgaggagttccacgtgaagcacgctggccacaacaactataatgtg
cagtatctggtgcgcgatcgcggccagtacgtgctcctaatcaagtggggcgaggagcat
atacccggctccccattccagatcgatgtgtag

DBGET integrated database retrieval system