KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3937Help
Entry
Dmel_CG3937       CDS       T00030                                 

Gene name
cher
Definition
cheerio
Orthology
K04437  
filamin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG3937 (cher)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:89E12-89F1; 3R:3-60 cM
AA seq 919 aa AA seqDB search
MHFSWLSEKAPTPPATWADHSYFFRPQYYKVTVSERDHPERTHVYFNETIIPENQGLNGS
DFMPLNFKSSFSIVTHQAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEGSHELVVKYNG
EPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGLTMAVEGPSKA
DINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRKRNQISVGSCS
EVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIGEHLVSVKRLG
KHINNSPFKVTVCEREVGDAKKVKVSGTGLKEGQTHADNIFSVDTRNAGFGGLSVSIEGP
SKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGEGSNRKREKIQ
RERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVEDGLYAVHFVPK
ELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGEAAEFNVWTRE
AGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRHIPDSPFKVYV
SPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTDDDCFIQVIDG
EMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGNGLDEVKTGHK
ADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYITVKYNNMHIV
GSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDASKVVSKGMGL
KKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQYLVRDRGQYV
LLIKWGEEHIPGSPFQIDV
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcagttggctgtcagagaaagcgcccacgccgccagccacctgggccgatcac
tcgtacttcttccgtccgcaatactataaggtgaccgtatccgagcgcgatcacccggaa
cggacgcacgtttacttcaatgagacgatcataccggagaaccaaggactaaatggttca
gattttatgccattgaatttcaaatcatcgttttcaattgtaacacatcaagctgaagtc
agaatgcctagcggtaaagtagacaaacccgtgatccaggacaaccgtgatggtaccgtc
tcggtgaagtacgatccccgtgaggagggatcccacgagctggtggtcaaatacaacgga
gaacccgtgcaaggatctcccttcaaattccacgttgactcgatcacctccggctatgtg
actgcctacggacccggcctgacccacggagtcaccggtgagccggccaactttaccatc
tccaccaagggagccagcgccggtggcctgaccatggccgtcgaaggacccagcaaggct
gacatcaactaccatgacaacaaagacggcactgtatctgtgcaatacctgcccactgct
cctggcgagtaccaggtgtccgttcgcttcggcgataagcacatcaagggatcgccgtac
ttcgccaagatcaccggcgagggtcgcaagcgcaaccagatctcggttggctcctgctcc
gaagtgaccatgcccggcgacattaccgatgacgatctgcgcgctttgaacgcctcgatc
caggcgcccagtggcctggaggagccctgcttcctgaagcgcatgcccactggcaacatt
ggcatctcgttcacgccccgcgagattggcgagcatctggtgtcggtgaagcgtctgggc
aagcacatcaacaactcaccatttaaggtgactgtctgcgagcgcgaggtgggcgacgcc
aagaaggtcaaggttagcggaactggcctcaaggagggtcaaacccatgccgacaacatc
ttctccgtggacacgaggaacgccggcttcggtggtctttcggtctccattgagggtccc
agcaaggctgagatccagtgcacggataaggatgacggtactctcaacatctcgtacaag
cccactgagccgggctactacattgttaacctgaagttcgccgatcaccacgtggagggt
tctcctttcaccgtcaaggttgccggcgagggcagcaaccgcaagcgcgagaagatccag
cgggagcgcgatgctgttccaatcacggaaatcggaagccagtgcaagctgacattcaag
atgccgggcattacctcgttcgatctggccgcctgtgtcacctcgcctagcaacgtgacc
gaggatgcggagatccaagaggtggaggatggcctctacgcagtgcactttgtgcccaag
gagttgggcgtgcacacggtgtcggtgcgctattccgagatgcacatacccggatcaccg
ttccagttcaccgtgggaccactgcgcgactccggcagccatcttgttaaggctggaggc
tctggtctggagcgaggtgttgtcggagaggcggccgagttcaatgtgtggacccgcgag
gcaggcggtggttccctggccatttccgtggaaggtcccagcaaggctgacatcgagttt
aaggaccgcaaggacggcagctgcgatgtgtcgtacaaggtcaccgaaccgggagagtac
cgcgtgggcctgaaattcaacgatcgccacatacccgactcaccattcaaggtgtacgtc
tccccggatgcgggtgatgcccacaagctggaggttcagcagttcccgcagggtaacatc
caggcggacgctccctaccaattcatggtccgcaagaacggtgccaagggtgagctggat
gccaagattgtggctccatccggaacggacgatgattgcttcatccaggtgatcgacggc
gagatgtactcggtgcgattctatccacgcgagaacggaatccatgccatccacgtcaag
ttcaacggcgtccacatacccgactctccattcaggatcaaggtgggcaaggatgtggcc
gatccagctgccgtgcacgccagcggcaatggattggacgaagtgaagactggacacaag
gccgacttcatcatcaacacctgcaacgccggcgttggcacgttggccgtctccatcgat
ggaccctccaaggtggccatggactgcacagaggttgaggagggctacaaggtccgctac
accccgctcctgcccggcgagcactacatcacggtcaagtacaacaacatgcacatcgtg
ggctcgccattcaaggtgaacgctaccggcgacaagttagcggatgagggcgcccaggag
acgtccacggtgatcgtggagaccgtgcagaaggtggccaaaggaggcaagaacacgggc
gtccatctgcccacctttaagtcggatgccagcaaggtggtgtccaagggtatgggcctg
aagaaggcctacattggcaagcagaaccagttcagcatcagcgccaccgatgcgggcaac
aacatcctgtacgtgggcatgtacggaccaaagggaccctgcgaggagttccacgtgaag
cacgctggccacaacaactataatgtgcagtatctggtgcgcgatcgcggccagtacgtg
ctcctaatcaagtggggcgaggagcatatacccggctccccattccagatcgatgtgtag

DBGET integrated database retrieval system