KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3989Help
Entry
Dmel_CG3989       CDS       T00030                                 

Gene name
ade5
Definition
CG3989 gene product from transcript CG3989-RB (EC:4.1.1.21 5.4.99.18 6.3.2.6)
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dmel_CG3989 (ade5)
Enzymes [BR:dme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dmel_CG3989 (ade5)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dmel_CG3989 (ade5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11B16-11B16
AA seq 428 aa AA seqDB search
MSTTTTASKGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEI
SNTTNGQVFRLLNEAGIRTAYVKQCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVP
EGYRFSPPKQETFFKDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMRRTTLLVFEIL
ERAWQTKNCALIDMKVEFGICDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLASV
TASDLDTVKRNFIWVAEQLADIVPKKDHLVVILMGSASDISHSEKIATSCRSLGLNVELR
VSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNM
QVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK
ELRGVRNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccaccacaacagcatccaagggctataagctcggcaaggtcatcatcgagggc
aaaaccaaacaggtgtacgatctgccagagcagccaggactttgcctgctcctcagcaag
gatcgcatcaccgccggcgatggtgtcaaagcacatgatctggccggcaaggcggagatc
tccaataccaccaacggtcaggtcttccggctgctcaacgaggcaggcattcgcaccgcc
tatgtgaagcagtgcggcgccaaggccttcatcgcccgcaagtgccagatgatacccatt
gagtgggtgacccgtcgcctggccaccggttcgttcctcaagcgcaatgtcggcgtgccc
gagggctacaggttctcgccgcccaaacaggagacgttcttcaaggatgatgccaaccac
gatccccagtggagcgaggagcaaattgtctccgccaagttcgagctaaatggcctggtg
atcggccaagatgaggtggacattatgcgtagaaccacactgctggtcttcgagattctc
gagagggcatggcagaccaagaattgcgccctgatcgacatgaaagtggagttcggtatc
tgcgacgatggcaacatagttctggccgatatcattgattccgattcgtggcgcttgtgg
ccagcgggtgacaagcgtttgatggtcgacaagcaggtgtatcgcaatctggcatcggtg
acggccagcgatttggataccgtaaagaggaacttcatttgggtggccgaacaactggct
gatattgtgcccaagaaggatcacctggttgtcattctgatgggcagtgcttccgatata
tcgcacagcgagaagatagccaccagctgtcgatccctcggccttaatgtggaacttcgc
gtgagttcggcccacaagggaccggaggaaacgttgcgcattgtccgcgaatatgaatcg
gtgatgagcaacttgatctttgtggccgtcgccgggcgatccaatggactgggtccagtc
gtttccggcagcaccaactatccggtaatcaattgtccgcccgtcaaatcggacaacatg
caggtggacgtgtggtccagcttgaatctgccatcggggctgggctgtgccacagttctc
tatccagaggcagctgctctgcatgcggccaccattctggggctgggcaacttcatggtc
tggtcgaaattgcgtgtcaaggcgctcaacaactttatcactctcaagaaggccgacaag
gagttgcgcggcgtgcgaaatgcttag

DBGET integrated database retrieval system