KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3992Help
Entry
Dmel_CG3992       CDS       T00030                                 

Gene name
srp
Definition
(RefSeq) serpent, isoform A
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 1264 aa AA seqDB search
MTKTTKPKEKAAAGGAVIGSGSGLGSVTKAGGGSLLSNAADSKIRTAKSNNNKRQAGRAA
TALAATTTASALAATTTAGATGSNAAANETEIAIETENGEAATPTAAATAAAANLSSLES
ARSQALTSVVSETARQAVTTANASATSTSTVTAATEIATATASDTAATSEAAIDDDPSAI
NTNNNNNNSKAQNDASESVKTKVISYHQSEDQQQQQQQQAQIYEQQQQFLSQQLISHHQQ
EQHQQAQQQQHQQVVQEQHQASWLAYDLTSGSAAAAAAAAAAASHPHLFGQFSYPPSHHT
PTQLYEHYPSTDPIMRNNFAFYSVYTGGGGGVGVGMTSHEHLAAAAAAAAAVAQGTTPNI
DEVIQDTLKDECFEDGHSTDYHVLTSVSDMHTLKDSSPYALTHEQLHQQQHHHQQQLHHH
QQQQQQLYHQQQQQQQQQQHHHHHNNSTSSAGGDSPSSSHALSTLQSFTQLTSATQRDSL
SPENDAYFAAAQLGSSLQNSSVYAGSLLTQTANGIQYGMQSPNQTQAHLQQQHHQQQQQQ
HQQHQQQQLQQQQQQHHHNQHQHHNSSSSSPGPAGLHHSSSSAATAAAVAAATAAVNGHN
SSLEDGYGSPRSSHSGGGGGGTLPAFQRIAYPNSGSVERYAPITNYRGQNDTWFDPLSYA
TSSSGQAQLGVGVGAGVVSNVIRNGRAISAANAAAAAAADGTTGRVDPGTFLSASASLSA
MAAESGGDFYKPNSFNVGGGGRSKANTSGAASSYSCPGSNATSAATSAVASGTAATAATT
LDEHVSRANSRRLSASKRAGLSCSNCHTTHTSLWRRNPAGEPVCNACGLYYKLHSVPRPL
TMKKDTIQKRKRKPKGTKSEKSKSKSKNALNAIMESGSLVTNCHNVGVVLDSSQMDVNDD
MKPQLDLKPYNSYSSQPQQQLPQYQQQQQLLMADQHSSAASSPHSMGSTSLSPSAMSHQH
QTHPHQQQQQQLCSGLDMSPNSNYQMSPLNMQQHQQQQSCSMQHSPSTPTSIFNTPSPTH
QLHNNNNNNNNSSIFNNNNNNNSSSNENNNKLIQKYLQAQQLSSSSNSGSTSDHQLLAQL
LPNSITAAAAAAAAAAAAAIKTEALSLTSQANCSTASAGLMVTSTPTTASSTLSSLSHSN
IISLQNPYHQAGMTLCKPTRPSPPYYLTPEEDEQPALIKMEEMDQSQQQQQQQQHQQQQH
GEIMLSRSASLDEHYELAAFQRHQQQQQQLQQQTAALLGQHEQHVTNYAMHKFGVDRETV
VKME
NT seq 3795 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaacgacaaagcccaaggagaaggcagcggcgggaggggcggttatagggtcg
ggatcgggattgggttcggtgaccaaggcgggcggcggtagtctgctttcgaatgcggcg
gacagtaagatccgcacggccaagtccaacaacaacaagcggcaggcaggacgagcggcg
acagcattagcagctacaacaacagcatcagccttagcggcaacaacaacagcgggagca
acaggatcaaatgcagcagcgaatgagacggaaatagcgatcgaaacggagaacggagaa
gcagcgacgccgactgcggcagcaacggccgccgcagcgaatttatcgtcacttgagtcc
gctcgctcgcaggctctcacttcagttgtcagcgaaacagcaaggcaagcggttaccaca
gcaaacgcgtcggcaacatcaacatcaacagttacagcagcaacagaaatagcaaccgca
acagcaagcgacacagcagcaacatctgaagcagcgatcgatgacgatccaagtgcgata
aatactaacaataataataataatagtaaagcgcagaacgacgcgagtgaaagtgttaaa
acaaaagtgataagctaccatcagtctgaggatcaacagcaacagcagcagcaacaagcc
cagatctacgagcaacagcaacagtttctcagccagcaattaataagccaccatcagcag
gaacagcatcagcaggcgcagcagcaacagcatcagcaggtggtgcaggagcaacaccag
gccagttggctggcctatgacctgaccagcggatcagcggcagcagcagcggcggcagcg
gcagcagcatcgcatccccacctcttcgggcagttctcctatccgcccagccatcatacg
cctacccagctctacgagcactaccccagcacggatcccataatgcggaacaactttgcg
ttctacagcgtctacaccggaggcggtggcggagtgggcgtgggcatgactagccacgag
catttggcagcggcggcggcagcggcagcagcagtggcccagggcaccacacccaacata
gacgaggtcatccaggacacgctgaaggacgagtgcttcgaggatggccacagcaccgat
taccatgtgctgacctccgtgtccgatatgcatacgctaaaggactccagtccctatgcc
ctcacccacgagcaactccaccagcagcagcaccatcaccagcagcaactgcatcaccat
cagcagcagcagcaacaactttaccaccagcaacagcagcagcagcagcagcaacaacat
catcaccaccacaacaactccaccagttcggcgggcggggactccccgtcgtcctcgcac
gcactgtccaccctgcagagcttcacccagctgaccagcgccacccagcgtgatagcctc
tcgccggagaatgacgcctactttgcggccgcccagctcggcagcagcttgcagaacagc
tctgtttatgctggctcgttgcttactcagactgccaatggcattcagtacggcatgcag
tcccccaaccaaacacaagcccatctccagcagcagcaccatcagcagcagcagcaacaa
catcagcaacaccagcagcagcaactgcagcagcagcagcagcaacatcaccacaatcaa
caccagcaccacaactccagcagcagcagtccggggccagcgggtctgcaccactcgagc
tcctcggcggccacggcggcagcggtggctgcggcaacggcggcggtcaatggacacaac
agctccttggaggacggctacggatcgccaaggagcagccacagtggcggcgggggcggt
ggtactctgccagccttccagcggatcgcataccccaacagtggctccgtggaacgttac
gctccgataaccaattatcgcggtcagaacgatacctggttcgatccgttaagctacgcc
acctcctcttccgggcaggcgcagttgggcgtcggtgttggagccggagtggtctcgaat
gtgatacggaatgggcgggccatttcggctgctaatgcagcagctgcagccgccgcggat
ggaaccactggacgcgtagatcctggaacctttctctccgcctcggcatcgttgtcagca
atggccgctgaatcaggcggggatttctataaacccaactcatttaatgtgggcggcggt
ggccgtagtaaggctaacacgagtggtgccgccagctcctactcctgtccaggctcgaat
gcaacctcggcggcgacttcggcggtggcgtcgggaacggcagcaactgcagcgacgacg
ctcgacgagcacgttagtcgcgccaattcgagacgcttgagcgcctcaaagcgagccgga
ctttcctgctccaactgccacaccacccacacttcgttgtggcgccgcaatcccgccgga
gagcccgtctgcaatgcatgcggcctgtactataagctccacagtgtcccacggccactg
accatgaaaaaggacaccattcagaaacgcaagcgcaagccgaaaggaacgaagagcgag
aagtccaagtcaaagtcaaagaacgctttgaatgccatcatggaaagtggttcattggtg
accaattgccataacgttggtgtcgtcctggacagcagccagatggatgtcaatgacgat
atgaaaccacagctcgatctgaaaccatacaactcatactcatcgcagccgcagcaacag
cttccacagtaccagcagcagcagcagctgctaatggctgatcagcactcatcggcggcc
agctcgccccatagcatgggttccacctcattgtcgccatcagccatgtcacatcagcat
cagactcatccacatcagcagcaacagcagcagctctgttccgggctggacatgtcgccc
aactcaaactaccaaatgtcgccgctcaacatgcagcagcatcagcagcagcaatcgtgc
agcatgcagcactcacccagcacacccacatccatcttcaacaccccatcgccaactcac
cagctccacaataacaataacaacaacaacaacagctcgatcttcaacaacaacaacaac
aacaatagtagtagcaatgagaataacaacaaacttatacagaaatatctgcaagctcag
caactgagcagcagcagcaacagcggctccaccagcgaccaccagttgctggcccaactg
ctgccgaactccattacggcggcagcagcagcagcagcggcggcggcagcggcggcgatc
aagacggaggccttgtcgctcacctcccaggccaactgctccacagcgtcggcgggactt
atggtcacctcaacaccgaccacggcatcgagcacattatcgtccctgagtcacagcaac
attattagtctgcagaatccgtatcaccaggccggaatgacgctgtgcaagcccacgaga
ccttccccaccctactacctgactccggaggaggatgagcagcccgctctcatcaagatg
gaagagatggatcagtcgcaacagcaacaacagcagcagcagcatcagcagcagcaacat
ggagagataatgctcagccgatcggcctcgctggacgagcactacgaactggccgccttc
cagagacatcagcagcagcagcaacagctgcagcagcagactgccgccctcttgggtcaa
catgagcagcatgtgaccaactatgcgatgcataagttcggcgttgaccgggaaacagtg
gtgaagatggagtag

DBGET integrated database retrieval system