KEGG   Drosophila melanogaster (fruit fly): Dmel_CG40300Help
Entry
Dmel_CG40300      CDS       T00030                                 

Gene name
AGO3
Definition
(RefSeq) argonaute 3, isoform D
  KO
K02156  aubergine
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG40300 (AGO3)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    Dmel_CG40300 (AGO3)
   piRNA pathway
    Dmel_CG40300 (AGO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi PAZ ArgoL1 GAIN Mga
Motif
Other DBs
NCBI-GeneID: 3355150
NCBI-ProteinID: NP_001036627
FlyBase: FBgn0250816
UniProt: Q7PLK0
Position
3L
AA seq 867 aa AA seqDB search
MSGRGNLLSLFNKNAGNMGKSISSKDHEIDSGLDFNNSESSGERLLSSHNIETDLITTLQ
HVNISVGRGRARLIDTLKTDDHTSNQFITSESKENITKKTKGPESEAIASENGLFFPDLI
YGSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTFD
GNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVK
FDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLY
QQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQY
HNINIKDVNQPLIYSIKKSRGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATF
TRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISV
SAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPT
MISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK
TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVA
SINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQL
YTCLNYEIPQFEMVCGNRIKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNM
YDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMY
AHKLAYLIGQSIQRDVAEALSEKLFYL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaagaggaaatttgttgagcttatttaataaaaatgctggcaatatgggaaaa
tcaatttcaagtaaagatcatgaaatcgacagtggcttggattttaacaactctgaatca
agtggagaacgtttactgtcaagccataatattgaaactgatcttataaccactcttcaa
catgtaaacatctcggtcggccgaggacgtgctaggcttatagacacattaaaaacagat
gaccatacatcaaatcaatttataacatctgaatcaaaggaaaacattaccaaaaagaca
aagggccccgaatcggaagcaattgcttcagaaaatggattattttttcccgatttaatt
tacggatctaaaggttcatctgttaatatatattgtaattacttaaagctaacgacggat
gaatccaagggagtttttaattacgaagtgcgtttttttcctcccattgactctgttcat
ttaagaataaaatatttaaatgatcataaggataaactcggtggaaccaagacatttgac
ggaaatactttatatttacctattttgttaccaaataagatgaccgtctttatttcaaag
gcggaagatgttgagttgcagattcgcattttatacaaaaaaaaagaggaaatgaggaac
tgcacgcaattatataatattttattcgatagagttatgaaagtattgaattacgtaaaa
tttgatcgcaagcagtttgatccttcgcgtccaaaaataataccactggcaaagttagaa
gtttggcctggctatgttacagccgttgacgaatacaaaggtggtttaatgctatgctgc
gacgtttcgcatcgtatactttgccaaaaaactgttctagaaatgctggttgatctttat
cagcaaaatgtagagcattaccaagaatcagcaagaaaaatgttggttggaaatattgtc
ttaactaggtataacaatcgtacatataaaataaatgacatttgttttgatcaaaatcca
acatgtcagtttgaaattaaaactggctgcacaagttacgtggagtattacaaacaatat
cacaatataaacataaaggacgttaatcaaccattgatttacagtataaagaaatcaaga
ggaattccagcagaaagggaaaatttacagttttgtttaattccagaattgtgttatctt
actgggctgcgagacgaagtacggtcagataacaagcttatgcgcgagattgctacattt
acaagagtttcgccaaatcaacgacagatggcgttaaataaattttacgaaaatgtttca
aatacacccgccgcacaagaaattctaaatagctggggtctttcattaacgaataattcc
aacaagataagtgggcgtcaaatggacatagagcaaatatatttttcaaaaattagtgta
tcggccggaaggtccgcagagttctccaaacatgctgtgaccaatgaaatgttgaaagta
gtccacctgagtaaatggatcattatacatttaagaaattatagacaagctgcaactagc
ttgctcgataacatgaaacaggcttgtgagtcacttggtatgaacatttctaacccaaca
atgatttcgttagatcatgaccgaatcgatgcctacattcaagcactgcggcgaaatata
actatgaatacgcaaatggtcgtatgtatttgtcataacagaagagatgatcgttatgct
gcaataaaaaaaatatgttgctcggaaatacctataccatcacaggttataaatgctaaa
actttacaaaatgatcttaaaattcgatccgttgttcaaaaaattgttctacaaatgaac
tgtaaactcggaggctcattatggacggtaaaaattccatttaaaaatgtaatgatttgc
ggaatagactcatatcatgacccatctaatcgggggaattctgttgctgcatttgtggcc
tccataaattcgtcgtattcacagtggtacagtaaagctgttgtacaaacaaaacgtgaa
gaaattgttaatgggctctctgcatcttttgaaattgcattaaaaatgtatcgtaaaagg
aatggcaaactccccacaaatattataatatacagagatggaattggagatggacagctt
tatacatgtcttaattatgaaattccacaatttgaaatggtgtgtggaaatcgcataaaa
atttcatatattgtagtccaaaaacgaattaacactcgcatcttctcgggtagcggcatt
catctagaaaacccattgccaggaactgtcgtagatcaacatataacaaaatcaaatatg
tatgatttttttttggtttcgcaattggtacgacagggtactgtaaccccaactcattat
gttgttcttcgagatgactgcaattatggacccgacataattcaaaaactaagttacaaa
ctttgttttttatattacaattgggctggtacagtacgaattccagcttgttgtatgtac
gctcacaaattggcttatttgattggacaaagtattcaacgagatgtggctgaagcactt
tctgaaaaactattttatctttaa

DBGET integrated database retrieval system