KEGG   Drosophila melanogaster (fruit fly): Dmel_CG40300Help
Entry
Dmel_CG40300      CDS       T00030                                 

Gene name
AGO3
Definition
Argonaute 3
Orthology
K02156  
aubergine
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG40300 (AGO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:80F9-80F9
AA seq 867 aa AA seqDB search
MSGRGNLLSLFNKNAGNMGKSISSKDHEIDSGLDFNNSESSGERLLSSHNIETDLITTLQ
HVNISVGRGRARLIDTLKTDDHTSNQFITSESKENITKKTKGPESEAIASENGLFFPDLI
YGSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLNDHKDKLGGTKTFD
GNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVK
FDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSHRILCQKTVLEMLVDLY
QQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQY
HNINIKDVNQPLIYSIKKSRGIPAERENLQFCLIPELCYLTGLRDEVRSDNKLMREIATF
TRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYFSKISV
SAGRSAEFSKHAVTNEMLKVVHLSKWIIIHLRNYRQAATSLLDNMKQACESLGMNISNPT
MISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDRYAAIKKICCSEIPIPSQVINAK
TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVA
SINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQL
YTCLNYEIPQFEMVCGNRIKISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNM
YDFFLVSQLVRQGTVTPTHYVVLRDDCNYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMY
AHKLAYLIGQSIQRDVAEALSEKLFYL
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaagaggaaatttgttgagcttatttaataaaaatgctggcaatatgggaaaa
tcaatttcaagtaaagatcatgaaatcgacagtggcttggattttaacaactctgaatca
agtggagaacgtttactgtcaagccataatattgaaactgatcttataaccactcttcaa
catgtaaacatctcggtcggccgaggacgtgctaggcttatagacacattaaaaacagat
gaccatacatcaaatcaatttataacatctgaatcaaaggaaaacattaccaaaaagaca
aagggccccgaatcggaagcaattgcttcagaaaatggattattttttcccgatttaatt
tacggatctaaaggttcatctgttaatatatattgtaattacttaaagctaacgacggat
gaatccaagggagtttttaattacgaagtgcgtttttttcctcccattgactctgttcat
ttaagaataaaatatttaaatgatcataaggataaactcggtggaaccaagacatttgac
ggaaatactttatatttacctattttgttaccaaataagatgaccgtctttatttcaaag
gcggaagatgttgagttgcagattcgcattttatacaaaaaaaaagaggaaatgaggaac
tgcacgcaattatataatattttattcgatagagttatgaaagtattgaattacgtaaaa
tttgatcgcaagcagtttgatccttcgcgtccaaaaataataccactggcaaagttagaa
gtttggcctggctatgttacagccgttgacgaatacaaaggtggtttaatgctatgctgc
gacgtttcgcatcgtatactttgccaaaaaactgttctagaaatgctggttgatctttat
cagcaaaatgtagagcattaccaagaatcagcaagaaaaatgttggttggaaatattgtc
ttaactaggtataacaatcgtacatataaaataaatgacatttgttttgatcaaaatcca
acatgtcagtttgaaattaaaactggctgcacaagttacgtggagtattacaaacaatat
cacaatataaacataaaggacgttaatcaaccattgatttacagtataaagaaatcaaga
ggaattccagcagaaagggaaaatttacagttttgtttaattccagaattgtgttatctt
actgggctgcgagacgaagtacggtcagataacaagcttatgcgcgagattgctacattt
acaagagtttcgccaaatcaacgacagatggcgttaaataaattttacgaaaatgtttca
aatacacccgccgcacaagaaattctaaatagctggggtctttcattaacgaataattcc
aacaagataagtgggcgtcaaatggacatagagcaaatatatttttcaaaaattagtgta
tcggccggaaggtccgcagagttctccaaacatgctgtgaccaatgaaatgttgaaagta
gtccacctgagtaaatggatcattatacatttaagaaattatagacaagctgcaactagc
ttgctcgataacatgaaacaggcttgtgagtcacttggtatgaacatttctaacccaaca
atgatttcgttagatcatgaccgaatcgatgcctacattcaagcactgcggcgaaatata
actatgaatacgcaaatggtcgtatgtatttgtcataacagaagagatgatcgttatgct
gcaataaaaaaaatatgttgctcggaaatacctataccatcacaggttataaatgctaaa
actttacaaaatgatcttaaaattcgatccgttgttcaaaaaattgttctacaaatgaac
tgtaaactcggaggctcattatggacggtaaaaattccatttaaaaatgtaatgatttgc
ggaatagactcatatcatgacccatctaatcgggggaattctgttgctgcatttgtggcc
tccataaattcgtcgtattcacagtggtacagtaaagctgttgtacaaacaaaacgtgaa
gaaattgttaatgggctctctgcatcttttgaaattgcattaaaaatgtatcgtaaaagg
aatggcaaactccccacaaatattataatatacagagatggaattggagatggacagctt
tatacatgtcttaattatgaaattccacaatttgaaatggtgtgtggaaatcgcataaaa
atttcatatattgtagtccaaaaacgaattaacactcgcatcttctcgggtagcggcatt
catctagaaaacccattgccaggaactgtcgtagatcaacatataacaaaatcaaatatg
tatgatttttttttggtttcgcaattggtacgacagggtactgtaaccccaactcattat
gttgttcttcgagatgactgcaattatggacccgacataattcaaaaactaagttacaaa
ctttgttttttatattacaattgggctggtacagtacgaattccagcttgttgtatgtac
gctcacaaattggcttatttgattggacaaagtattcaacgagatgtggctgaagcactt
tctgaaaaactattttatctttaa

DBGET integrated database retrieval system