KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4035Help
Entry
Dmel_CG4035       CDS       T00030                                 

Gene name
eIF-4E
Definition
Eukaryotic initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG4035 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG4035 (eIF-4E)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmel_CG4035 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3L:67B4-67B4
AA seq 259 aa AA seqDB search
MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGN
TATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLY
NHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCL
IGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQ
LHKDTMVKQGSNVKSIYTL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgactttcacagaatgaagaactttgccaatcccaagtccatgttcaaaacc
agcgcccccagcaccgagcagggtcgtccggaaccaccaacttcggctgcagcgcccgcc
gaggctaaggatgtcaagcccaaggaggacccacaggagactggtgaaccagcaggcaac
actgcaaccactactgctcctgccggcgacgatgctgtgcgcaccgagcatttatacaaa
cacccgctcatgaatgtctggacgctgtggtaccttgaaaacgatcggtccaagtcctgg
gaggacatgcaaaacgagatcaccagcttcgataccgtcgaggacttctggagcctatac
aaccacatcaagcccccatcagagatcaagctgggtagtgactactcgctattcaagaag
aacattcgtcccatgtgggaggatgcagccaacaaacagggcggtcgttgggtcattacc
cttaacaaaagctccaagaccgatctggataacctatggctcgatgtgctgctctgcctg
attggtgaggccttcgatcactctgatcagatctgcggcgctgttataaacattcgcggc
aagagcaacaagatatccatctggactgccgacggaaacaacgaggaagctgcccttgag
attggtcacaagctgcgcgatgccctgcgtctgggacgcaacaactcgctgcagtatcag
ttgcacaaggacacgatggtcaagcagggctccaacgtgaaatcgatctacactttgtag

DBGET integrated database retrieval system