KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4035Help
Entry
Dmel_CG4035       CDS       T00030                                 

Gene name
eIF-4E
Definition
(RefSeq) Eukaryotic initiation factor 4E
  KO
K03259  
translation initiation factor 4E
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG4035 (eIF-4E)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG4035 (eIF-4E)
Messenger RNA biogenesis [BR:dme03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Dmel_CG4035 (eIF-4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Dmel_CG4035 (eIF-4E)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Dmel_CG4035 (eIF-4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3L:67B4-67B4
AA seq 259 aa AA seqDB search
MQSDFHRMKNFANPKSMFKTSAPSTEQGRPEPPTSAAAPAEAKDVKPKEDPQETGEPAGN
TATTTAPAGDDAVRTEHLYKHPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLY
NHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSKTDLDNLWLDVLLCL
IGEAFDHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQ
LHKDTMVKQGSNVKSIYTL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcgactttcacagaatgaagaactttgccaatcccaagtccatgttcaaaacc
agcgcccccagcaccgagcagggtcgtccggaaccaccaacttcggctgcagcgcccgcc
gaggctaaggatgtcaagcccaaggaggacccacaggagactggtgaaccagcaggcaac
actgcaaccactactgctcctgccggcgacgatgctgtgcgcaccgagcatttatacaaa
cacccgctcatgaatgtctggacgctgtggtaccttgaaaacgatcggtccaagtcctgg
gaggacatgcaaaacgagatcaccagcttcgataccgtcgaggacttctggagcctatac
aaccacatcaagcccccatcagagatcaagctgggtagtgactactcgctattcaagaag
aacattcgtcccatgtgggaggatgcagccaacaaacagggcggtcgttgggtcattacc
cttaacaaaagctccaagaccgatctggataacctatggctcgatgtgctgctctgcctg
attggtgaggccttcgatcactctgatcagatctgcggcgctgttataaacattcgcggc
aagagcaacaagatatccatctggactgccgacggaaacaacgaggaagctgcccttgag
attggtcacaagctgcgcgatgccctgcgtctgggacgcaacaactcgctgcagtatcag
ttgcacaaggacacgatggtcaagcagggctccaacgtgaaatcgatctacactttgtag

DBGET integrated database retrieval system