KEGG   Drosophila melanogaster (fruit fly): Dmel_CG40478Help
Entry
Dmel_CG40478      CDS       T00030                                 

Gene name
Dyrk3
Definition
Dual-specificity tyrosine phosphorylation-regulated kinase 3 (EC:2.7.11.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dmel_CG40478 (Dyrk3)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dmel_CG40478 (Dyrk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
4:102F8-102F8
AA seq 828 aa AA seqDB search
MVGSQEKKNNHIELSETPATDKNNLNTTHLENTQLSKALSPPTSLPQIQIQMINQNLTHT
GIAQNNTEKANRHQYRDSGLQYLTRCFEPLAMLNDSKEDFPTQPSNNIANYPGDIQILPI
FDCCEISESIQAISLPNVTSPSKTKDVPGLFLRTISENSKSKSEPECESLISVKESSVME
NHTFLFHEQIIMSGQQKCELHEKPKVLVVSPQQVMILYMNKLTPYERTEILTYPQIYFIG
ANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHE
HVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSI
NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKV
IDFGSSCFENQRIYTYIQSRFYRAPEVILGGKYGRAIDMWSLGCILAELLSGHALFPGEN
ESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGK
QRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLPRPPSSS
SGCGGVSGLCSSRNESPVTGQNRNFAAETTASSTSATSISLTIKRENSHSSLRLHHGAVP
ETDFKLIKSVPEGSSTATKEPMMNSDILPESFRQTTVVSPSKHSADSGGMSCLSAVDVGP
SRYYPYMNNNENNRLFSSSLNSSANSLSHLEQATKLDALGEYSASTTPNLLSKNTGYSFN
SGSINIDVAQESLVNIASNYALDKSIDIIGKSNVSLHTNKLKVQSKDM
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggtcggttctcaagaaaaaaaaaacaatcatatcgaattatctgaaacacccgcaaca
gacaaaaataatttaaacacaactcatctggaaaacacacaactctcaaaagcactttca
cctcctacatcactacctcagatacaaattcagatgattaaccaaaatttaacacatact
ggtatcgctcaaaataatactgaaaaagccaaccgtcatcaataccgggacagtggatta
caatatttaacccgatgctttgaaccattggcaatgctcaatgatagtaaagaagacttt
cccacgcagccatcaaataatattgccaattaccctggagatattcaaattttacccatt
ttcgattgctgcgaaatttcagagtctattcaagcaatatcgttgcctaatgtaacatct
ccatcaaagacaaaagatgttcctgggttgtttttgcgtacgatttcggaaaattcgaaa
tcaaagtcggaacccgaatgtgaatcgctaatttcagtcaaagaatcttctgtaatggaa
aaccacacctttttatttcacgaacaaattattatgtctggccaacaaaaatgtgaatta
cacgagaaaccgaaggttctggtagtttccccacaacaagtaatgattttatatatgaat
aaactaactccatacgagcgaacagaaatactaacttatccgcagatatattttattggc
gccaacgctaagaagcgcccaggagtctatggcccaaataattctgaatacgacaatgaa
caaggcgcttacattcatgtaccgcatgatcacgtagcatatcggtatgaaatgctaaag
ataatcggaaaaggtagctttggacaggtcattaaagcgtatgatcataaaactcacgaa
catgttgccttaaaaatagtgcgcaatgaaaagcggtttcaccgccaggcccaagaggaa
attcgcattcttcatcatttacgccgtcacgataaatataatactatgaacatcatacac
atgtttgattactttactttccgcaatcatacatgcattacatttgagctgctcagcata
aatctttacgaattaattaagaaaaatggatttaaaggcttcagtttgcagctggtgcga
aagtttgcacactctttgctacaatgtttggatgcactatataaaaatgatattattcat
tgcgatatgaaaccagaaaatgtgctactcaagcaacaaggacgttctggtataaaggta
attgactttgggtcgtcatgcttcgagaaccagcgtatatacacatatatccagtctcgt
ttttatcgcgctccagaggtaattttggggggaaaatatggcagagctatcgacatgtgg
tcgttgggttgtattttagcagagctgctttcaggccatgcattgtttcctggtgaaaac
gaaagcgatcagttggcttgcatcattgaagttttaggaatgcccaataaaaatatacta
gccagctcgaagaggtcaaaatcgtttttcagtccaaaggggtatcctcgatattgtacg
gttcgaacgatgtctgatggaatggtggtcctaatcggcggacagtcacgtcgtggaaaa
caaaggggcccgccatgctcaaaaagtctatctaaggcgctggatggatgcaaagatcca
ctctttcttaattttatacgtggttgccttgaatgggatgcagacaagcgattaacacct
tccgaggctttaaaacatccatggcttcgccgtcgcttaccgagaccaccaagtagctca
agtggctgtggtggggtgagtggattatgttctagtaggaacgaatccccagttacaggg
cagaataggaacttcgcagcagagacaactgcatcatcgacgtctgctacatctatatct
ttaacgattaaaagggaaaatagccattccagtcttcgtcttcaccatggtgctgttcca
gaaacggacttcaaacttataaaatccgttccagagggatcatcaaccgcaacaaaagaa
cctatgatgaacagtgacattcttccagaaagttttagacaaacaactgttgtatcacca
tcaaaacattctgctgactccggcggaatgagttgtcttagcgctgtggatgtcgggcca
tcgagatattatccgtatatgaataacaatgaaaataacaggttattctcgagctcgtta
aacagttcggccaactcattgtcacatttggagcaagccacaaaattagatgctttggga
gaatactcggcgtcaactacaccaaatttactatcaaaaaatactggctactcgtttaac
tcaggttctattaacatcgatgttgcacaagagtctttggttaatatagctagtaattac
gcattggataaatctatcgacattattggaaaatcaaatgtgtctcttcatacgaataaa
ttaaaagtacaatcgaaggatatgtag

DBGET integrated database retrieval system