KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4107Help
Entry
Dmel_CG4107       CDS       T00030                                 

Gene name
Pcaf, Gcn5
Definition
Gcn5 ortholog (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Dmel_CG4107 (Pcaf)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dmel_CG4107 (Pcaf)
Transcription machinery [BR:dme03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dmel_CG4107 (Pcaf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:69C4-69C4
AA seq 813 aa AA seqDB search
MSGGPSITIKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSAQNPGHGGAASGAGS
VPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENRHRDV
ESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDED
TKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTPELQT
MTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCET
SLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKDDSPI
WDTSYRPSNSFVIQQRKRNQEVANVPIGPSAASIGGNKRTSVGEPLHKRIKKEPTDRPSS
ENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLT
KPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFP
SQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSK
DIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKV
RPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFASVLQSV
RQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNC
RFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtggtccatccataacgataaaaagccaaccaatcgatggtaacaacacgggc
aacgctgcggcgcaacagcagcagcaggcagcgaatggcgcagcaaccgctggtgcatct
ggagccgctggcagcgcccagaatccaggacacggaggagctgcgtccggcgctggcagt
gtgccggcagagggaacgcgccagaacagcctacagcgcattcagcagcgaaagcaaaag
gtcttcaatctgcccgtgccacagaaactggccaaattgtcgatgtattccgcctgccag
tctgagggatgccgttgcaccggctggaagacaccgcaggaaaatcgccaccgtgacgtc
gagtcctcctactgtccggagttcaacgaggagtgccgcaacaccagctgtcgccattcg
ctgagatcgcacatagcccatctggacaatatatccagttccagcatgaacgagctactg
ggcgccattatagacatggagaacctattcatgtccatgcagcgcgtcgaggacgaggac
accaagaaggtgtaccagtacctcttccgtttgctgcgccagtgcgtcctcacgcgccag
caggcggtcatccggggtcctctcggcgatccaccattcgagacgccgtgcatcaccaag
gctgtgctctcgttggtcttctacaagtacaatcacctgagcacgcctgaactccaaacc
atgaccgaggtggccaagacgttcttgaactttctgaaccactacaactttgaatcgccg
tcgaccaggagaggagatctcacccacgaggatgcctctaactacaaaatcaactacacc
aggtggttggtgttctgccacgtgcccgccttctgtaactccctgcgccaatgtgaaacg
tccctagtgtttggacgaacgctcctgcgcaccgttttccagtgcatgtcgcagcagctg
aaaaagaagtgcatctccgagcgggatcgctttcccgaggacaagcgttcgatcatcacg
ctgatgccgaagtttttggaaacgcttcgcgccgaattgctcaaggatgattcgcccatc
tgggataccagctaccgcccgtcaaattcctttgtcatccagcagagaaagcgtaaccag
gaggtggcaaatgtacccattggtcccagtgcagcaagcattggtggaaacaagaggacc
agtgtgggtgaaccgctccacaagcgaatcaaaaaggagcccaccgatcgtccaagcagt
gagaatttggatgacctgcctgcggatgtagtaatgcgcgccatgaaatcggtgtccgag
tcgaagaccaccaacaaagcggaaattctctttccggttaatgtgtcgcgggatgagaac
gtcaaggcggaggagcagaagcgagccattgagttccatgtggtgggcaattcgctgacc
aaaccggtggacaagcagactgttttgtggctactgggcctgcagctcgtatttgcctat
cagctacccgagatgccgcgcgagtacatcagccagttggttttcgacaccaagcacaaa
acactggcgctcatcaaggaaaaccaacccatcggcggcatctgtttccgcccgtttccg
tcgcaaggcttcaccgagatcgttttctgcgcggtcaccatgtcggaacaagttaagggc
tatggcacgcacttgatgaaccacttgaaggactacagcatacagaggggtatcaagcat
ctgctcacattcgccgattgcgatgccatcgggtacttcaagaagcagggtttctccaag
gacatcaaattggcgcgaccagtttatgcgggctacatcaaggagtacgatagtgctact
ctcatgcactgcgagctgcatccaagcattgtgaacacgcagttcatagctgtaattcgc
agtcagagcgagattctgaaggagctgatcgcacagcgccacaacgaggtgcagaaagta
agacccggcttgacttgcttcaaggagggcctgcccgtgattcccgtggaatcgattcct
ggtctgcgggagatcggttggaagccgcaaaatcgtccggcgcgctcatcgcgacccctc
gaggaatccaccgatccggagaagctggccacgtcctttgcatccgtgctgcaatccgtg
cgccagcacaccaccgcctggcccttcctgcgcccggtgaccgcggccgaagttccggac
tactacgatcacattaaatatcccatggacctgaagaccatgggcgagcgcctgaagaag
ggttactaccaaacgcgccgcctgttcatggcggacatggcgcgcattttctccaactgt
cggttctacaattcgcccgacaccgagtattatcggtgtgccaactccctggagcgctac
ttccagaccaagatgcgcgagctggggctgtgggacaaatga

DBGET integrated database retrieval system