KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4141Help
Entry
Dmel_CG4141       CDS       T00030                                 

Gene name
Pi3K92E
Definition
(RefSeq) Pi3K92E, isoform C
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00562  Inositol phosphate metabolism
dme04068  FoxO signaling pathway
dme04070  Phosphatidylinositol signaling system
dme04140  Autophagy - animal
dme04150  mTOR signaling pathway
dme04213  Longevity regulating pathway - multiple species
dme04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dmel_CG4141 (Pi3K92E)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dmel_CG4141 (Pi3K92E)
   04070 Phosphatidylinositol signaling system
    Dmel_CG4141 (Pi3K92E)
   04150 mTOR signaling pathway
    Dmel_CG4141 (Pi3K92E)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    Dmel_CG4141 (Pi3K92E)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG4141 (Pi3K92E)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    Dmel_CG4141 (Pi3K92E)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     Dmel_CG4141 (Pi3K92E)
Membrane trafficking [BR:dme04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    Dmel_CG4141 (Pi3K92E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PI3K_p85B DUF4135
Motif
Other DBs
NCBI-GeneID: 42446
NCBI-ProteinID: NP_001262770
FlyBase: FBgn0015279
UniProt: P91634
Position
3R
AA seq 1088 aa AA seqDB search
MNMMDNRALAYVAHQPKYETPPEEAEPPCMRFSVNLWKNEMLNWVDLICLLPNGFLLELR
VNPANTIQVIKVEMVNQAKQMPLGYVIKEACEYQVYGISTFNIEPYTDETKRLSEVQPYF
GILSLGERTDTTSFSSDYELTKMVNGMIGTTFDHNRTHGSPEIDDFRLYMTQTCDNIELE
RSAYTWQQRLLYEHPLRLANSTKMPELIRERHPTRTFLIVVKNENDQSTFTLSVNEQDTP
FSLTESTLQKMNRSQMKMNDRTSDYILKVSGRDEYLLGDYPLIQFLYIQEMLSDSAVPNV
VLQSVYRLESYINHHNEQAMVTKRPLPKKRTVHLHKSISSLWDMGNYFQLTLHSISNVNF
DKTRALKVGVHVCLYHGDKKLCAQRSTDSPNGNFDTFLFNDLVMDFDIQMRNLPRMTRLC
IVIFEVTKMSRSKKSSNNKDIALKDVPYNKNPLAWVNTTIFDHKDILRTGRHTLYTWTYA
DDIQSVEVFHPLGTIEPNPRKEECALVDLTFLSSGTGTVRYPSEEVVLQYAADREQVNRL
QRQLAGPEKPIKELKELMANYTGLDKIYEMVDQDRNAIWERRNDILRELPEELSILLHCV
YWKERDDVADMWYLLKQWPLISIERSLELLDYAYPDPAVRRFAIRCLHFLKDEDLLLYLL
QLVQAIKHESYLESDLVVFLLERALRNQRIGHYFFWHLRSEMQTPSMQTRFGLLLEVYLK
GCKHHVAPLRKQLHVLEKLKQGSLIAKKGSKEKVKTMLQDFLRDQRNSAVFQNIQNPLNP
SFRCSGVTPDRCKVMDSKMRPLWVVFENADVNASDVHIIFKNGDDLRQDMLTLQMLRVMD
QLWKRDGMDFRMNIYNCISMEKSLGMIEVVRHAETIANIQKEKGMFSATSPFKKGSLLSW
LKEHNKPADKLNKAINEFTLSCAGYCVATYVLGVADRHSDNIMVKRNGQLFHIDFGHILG
HFKEKLGVRRERVPFVLTHDFVYVINKGFNDRESKEFCHFQELCERAFLVLRKHGCLILS
LFSMMISTGLPELSSEKDLDYLRETLVLDYTEEKAREHFRAKFSEALANSWKTSLNWASH
NFSKNNKQ
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgatggacaaccgggcgttggcctacgtggcccaccagcccaagtatgagaca
ccgccggaagaagcggagccgccctgcatgcgcttttcggttaacctgtggaaaaacgag
atgctgaactgggtggacctaatctgcctgttgcccaatggattcctgctggagctcagg
gtcaatccggccaacaccatccaggtaatcaaggtggagatggtcaaccaggccaaacag
atgccactgggctatgtgatcaaagaggcctgcgagtaccaggtgtacggcatctcgacc
ttcaacatcgaaccttacaccgacgaaacgaagcgactcagtgaggtccagccgtacttc
ggcatcctcagcctcggcgagcgcaccgacacaacgagctttagcagcgactacgagctg
accaagatggttaacggaatgatcggcaccaccttcgatcataatcgaacgcacggctcg
cccgagattgacgacttccggctgtatatgacccaaacttgcgacaacatcgaactggag
cgctccgcctacacctggcagcagagactgctctacgagcatcctctgcgactggcgaac
tcgactaaaatgcccgagctgatacgggagcggcatccgaccagaacctttctcatcgtc
gtaaagaacgagaacgaccagagcacgtttacgttgtcggtgaacgagcaggacactccc
ttctcgctcacggaaagcacgctgcagaagatgaatcggtcgcagatgaaaatgaacgac
cggacctccgactacatactcaaagtgagcggtcgcgacgagtacctgcttggcgactat
cccctgattcagttcctgtacatccaagagatgctctcggactcggcggttccaaatgtg
gtgttgcaatcagtttaccgcctagagtcctacatcaaccaccacaacgagcaggccatg
gtaaccaaacgaccgctgccgaagaaacggacagtccacctccacaagtcgatctcctcg
ctgtgggacatgggcaactactttcagttgacgctgcacagcatttccaatgtgaacttt
gacaagacgcgtgccctcaaggtgggcgtgcatgtgtgcctatatcacggcgacaagaag
ttatgcgcccagcgatcaacggactcccctaacggcaactttgacacgttcctgtttaat
gacctggtgatggactttgacatacagatgcgcaacctaccgcggatgacacgcctctgc
attgtgatcttcgaggtgaccaagatgtcgcgctcgaagaaatcgtccaacaataaggac
atcgctctgaaagacgtcccgtacaacaaaaacccgctggcctgggtcaacacaacaatt
ttcgaccacaaggacatcctgcgcaccggtcgccatacgctgtacacgtggacgtatgct
gacgacattcagtcggttgaggttttccatccgctgggcaccatcgaacccaatccgcgc
aaagaggaatgtgcgctggtggacctcacattcctcagcagcggaaccggaacggtgcgg
tatcccagcgaggaggtcgtgttgcagtacgctgcggatcgagagcaggtcaatcgactg
caacggcaactggcagggccagaaaagccgatcaaagaactgaaggagcttatggccaat
tatacaggactggataagatctatgagatggttgaccaggaccgcaatgccatttgggaa
cgcagaaacgacattttgcgtgagcttccggaagagctgtccatcttacttcactgcgtc
tattggaaggagcgtgatgacgtagcggatatgtggtatcttctcaaacagtggccgctt
atttctatagaacgctccttggagctactggactacgcctatccagatccggcagtgaga
cgctttgccatccggtgcttacactttctgaaagacgaagacttgctcctgtatctgctg
caattggtacaggccatcaagcacgaatcgtacctggaaagcgatctggtagtgtttctg
ctggagcgggcactgcgcaaccaacgcatcggccactacttcttctggcacctacgctct
gagatgcagacgccgtctatgcaaacacgctttggcctactgctggaggtatacctcaag
ggttgcaaacatcacgtggcgccgctgcggaagcagcttcatgtgctagagaagctgaaa
cagggatctctgattgccaagaagggcagcaaggaaaaggtgaagaccatgctgcaggac
tttctgcgggaccagcgcaactcggctgtctttcagaacatccaaaatccacttaatccc
agcttccggtgcagtggtgtaactcccgataggtgcaaggtaatggatagcaagatgcga
ccgctatgggtggtattcgagaatgctgacgtcaacgccagcgatgtgcacatcattttc
aaaaacggtgacgatctccgccaggacatgctcacgttgcagatgttgcgtgtgatggac
cagctgtggaaacgcgatggtatggacttccgcatgaacatctacaactgcatcagcatg
gagaagagcctgggcatgatcgaggtggtgcgccacgcagaaaccattgccaacatacaa
aaggaaaagggcatgttctccgccacgtcgccgttcaagaagggctcgcttctcagttgg
ctcaaagagcacaacaagcccgccgacaaactgaacaaagccatcaacgagttcacgctc
agctgtgcaggctactgcgtggccacctatgtgcttggcgtagctgatcgacactcggac
aatataatggtcaagcgaaatggacagctttttcacatcgattttggccacatcctgggc
cacttcaaggaaaagcttggagtacgtcgagaacgagtgccctttgtcttgacccacgac
tttgtctacgtaatcaacaagggcttcaatgaccgcgagtctaaagagttttgtcatttt
caggaattgtgcgagcgcgcctttctagttttacgcaaacacggctgccttattctatcg
ctgttctcaatgatgatttcaacgggactgccagaactgtcctccgaaaaggatttggac
tacctacgggaaactttagtgctggactacacggaggaaaaagcacgcgaacatttccga
gcgaaattcagcgaagctttggccaactcctggaagacttcccttaactgggcctcgcac
aacttctccaaaaacaacaaacagtaa

DBGET integrated database retrieval system