KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4165Help
Entry
Dmel_CG4165       CDS       T00030                                 

Definition
CG4165 gene product from transcript CG4165-RD
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG4165
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG4165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:4F10-4F10
AA seq 1126 aa AA seqDB search
MVKKRQADSRDHDCSTDSGNEDLHHRKGLGSPGQSDGATPTTASCQHIKKAVDAARLRRL
LKSTGLLYECSQCQKLGKTAGSAAGAGASEGAVGPGGNPVTFEFDNTLWLCLKCGSQLCG
RARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKICSNLRKNLLECVELVKKLAQK
PPTSTVTPSTPTISYIEEKLKAALEHLTPIVPMTGGSFDDSSSRGSLAAAGGGGGVGSSR
NRQVAIPMPPPEPSSGLSTSDSLTSVPGMAKRIDQYSATTNGNTGNKRLLTLETPRIENE
RLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSVLKELSEPGEEFILPGGTFTIKDKGDIE
LPMIKGTLSSWGGLTAALANALEELQAGGSVFTPRKLFDRLCVKCPQFTGGDQHDAHELL
RQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFR
GFLVSTLTCQDCHNVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELSLTSSSSSVTPSTG
QPTINTKFTDGSVNFTASSPSFFLHAHEAASLGPSKSQVKKEKERQRKAKRAAKKRQKSS
LNLNGNDSGNGNELAESVDQDDASLASLGAGDGQANDGLEQTNGQTEDSTTSSVTTSEHS
DADVEDNLVEDTAAPSTNNVPSSTASLTAPSKTYMDSNGNAQPPGEKRDDTPEHMDKDSL
EEDENDSGIATSPAPTATNSSTSTSATGNNNSVAGSGLSGSSGALEDPLAPASLVTAGLS
EKGASVIRQVSVGAEQGASNGTEDADGEAKAIEQPEKTPSQAQAMAQAQARTKRVRTQSY
SDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCDSCTQRINGSDPKAKSVNT
NATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNID
RKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVAPGDKRWKFLPHGSKAELDQDDDQL
KKLEELLAKEKAREQHLKVLDDSDDFSNSSSNSSTSDESQTPATPLEEQQTQQAQQPQQP
QQLEEAANVRAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 3381 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagcgtcaggcggacagtcgcgaccacgattgctcaacggattccggcaat
gaggatctgcatcatcgaaaaggactcggctcgcccggtcagtcggatggcgccaccccc
accaccgccagctgccagcacatcaagaaggcggtggacgcggcccgactaaggcgtcta
ctgaagtccacgggtctactctacgagtgcagccaatgtcagaagctgggcaagacagcg
ggcagcgctgcgggagcgggagcgagtgaaggagctgtcggtcctggcggaaatccggtc
accttcgaatttgacaacaccctgtggctgtgcctcaagtgcggcagccagctgtgcggg
agggcacgccacaagcacgccttagaacactaccagacacctcattcggactcacatgcc
ctggccatgaatacgcgctccttcgacatctggtgctatgagtgcgacatgaagatctgc
tccaatctgcgcaaaaacctgcttgagtgcgtggagctggtcaagaaattggcccagaag
ccgcccactagcacggttacgcccagtacgccaacgattagctacatcgaggagaagctt
aaagccgcgctggagcatctcacaccaatagtgccaatgactggcggatcatttgacgac
tccagcagtagagggtctctggcggcggccggtggcgggggcggggtcggttcatctcga
aataggcaggtggccataccgatgccaccaccagagcctagctccggactttcgacctca
gactcgctgaccagtgtgccgggtatggcaaagagaattgaccagtactcggccaccacc
aatggcaacactgggaacaaacgactcctgaccctagagacgccgcgcatcgaaaatgaa
cgcctgccccgcgtgcgaggattgaccaacctgggcaatacatgcttctttaatgcggtg
atgcagtgcctcgcccagacgccgttcctacttagcgtactgaaagaactgtcggagccc
ggagaagaattcatcttacctggcggaacgttcaccataaaggacaaaggtgacattgag
ctgccgatgatcaagggtaccctgtcctcttggggtggactcacggccgcgttagccaat
gcccttgaggaactgcaggctggcggtagtgtatttacgcccagaaaactcttcgacagg
ctgtgcgtaaagtgtcctcagtttacgggcggcgatcagcatgatgctcacgaactgctg
cgccagctactggagagcgtgcggaacgaggacctaaagcgctaccagcgtgtaattctg
cagaacctcggctacaaggatcaggatgtaaatagtgtgtcagaggagatgcgacaaaag
tgcaagatctatggcaatcaagcaggagaccgaattctgcgcccggaacaggtattccgt
ggctttcttgtgtcaacgctcacctgccaggattgtcacaatgtttcctcgcggcacgag
tacttcctggacatgtcgctgcccgtggccgtagagaaacctcagccgccgcagcgccga
aagccaagtccggagctcagtcttacgtccagcagctctagcgtcaccccgagcactggc
cagccgacgataaacaccaagtttacggatggtagtgtcaactttacagcctcatccccg
tccttcttcctgcacgcccatgaggcggcatccctgggcccatccaagtcgcaggtgaaa
aaggagaaggagcgacagcgtaaggcgaagcgggcggccaagaagcgtcagaagtctagc
cttaatctgaacggaaatgatagcggaaatggcaatgaattggccgagtccgtagaccag
gacgatgcctcattggcttccctgggtgccggcgacggccaggccaatgatggcctcgaa
cagaccaacggccagaccgaggattccaccacctccagcgtgactacttcggagcactcc
gacgccgatgttgaggacaatctggtggaggatacagccgcgccgtccactaataatgtg
ccgagcagtacggcatccttgacagctccctccaagacctacatggacagcaatggcaat
gcccagccgccgggggagaagcgcgacgatacgccggagcacatggacaaggattcgctc
gaagaggacgagaatgactcgggaatcgccaccagtccagcaccaactgctaccaacagc
agcaccagtaccagtgccacagggaacaataactctgttgccggatcggggctgtccggt
tcatcgggcgctctggaggatcccttggcgccagccagcttggtcactgccggactctca
gagaagggcgcctcggtgatccgccaggtctcggtgggagctgagcagggcgcatccaat
ggcacagaagacgcggatggcgaagccaaggcaatcgagcagccagagaagactcctagc
caagctcaagccatggctcaggcccaggcccgtacgaagcgagtgcgcacgcaaagctac
tcggactggagcaccacgatagcgccgcgctaccagtgcgaggatggagagtgctccgtg
cagtcgtgcctcaataatttcaccgctgtcgagctgatgacgggacagaacaaggtggga
tgcgatagctgcacgcagcgcattaacggcagtgatccgaaggccaagtcggtgaacacc
aatgccacgaaacagctgctggtctccagtccgccagcggtgctcatactacacctgaag
cgttttcagctgggaccgcgctgcatcttccgcaagctgacgcgcccggttagctatccc
aatctgctggacattgccgccttttgtgggtccaaggtcaagaatctgccgaacatcgat
cgcaagcagaagaagctgttgtacgcgctatatggcgtagtggagcactcgggcggcatg
tacggtggccactatacggcgtacgtgaaggtgcgtccaaaggtggcgccgggcgacaaa
cgctggaagttcctgccgcatggcagcaaggcggaattggaccaggacgatgaccaacta
aaaaaactggaggagctgcttgccaaggagaaggcgcgcgagcagcacctgaaggtgttg
gacgacagcgatgactttagcaactccagcagcaactcgtccacctccgacgagagccag
accccagccacgccactggaggagcaacagacgcagcaggcgcagcagccgcagcagccg
cagcagctggaggaggctgccaacgttcgtgcgccgcctggcaaatggtattacgtgtcc
gactcgcgtgtccaggaggtcagcgaggatacggcgctgaaggcgcaggcctatctgctt
ttctacgaacgcatatactag

DBGET integrated database retrieval system