KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4209Help
Entry
Dmel_CG4209       CDS       T00030                                 

Gene name
CanB
Definition
(RefSeq) calcineurin B, isoform B
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4209 (CanB)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmel_CG4209 (CanB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 44317
NCBI-ProteinID: NP_001245531
FlyBase: FBgn0010014
UniProt: P48451 M9NFW6
Position
X
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagacctccctgcccatggacatgtgttccaacttcgatgcggacgagatc
cgtaggctgggcaagcgattccgcaagctggatctggacaactcgggtgcgctgagcata
gatgagttcatgtcgctgccggaattgcagcagaatccgctggtgcagcgggttatcgat
atcttcgatgcggatggaaacggggaggtggacttcaaggagtttatccagggagtgtcg
cagtttagcgtgcgcggcgataagctgtccaagctgcgattcgccttccgcatctatgat
atggacaatgatggctacatctcgaacggggaactcttccaggtgctcaagatgatggtg
ggcaacaatctgaaggacacacagctgcagcagatcgtggacaagaccatttgctttgcg
gacaaggacgaggatggcaagatatcgttcgatgaattctgctcggtggtgggcaatacc
gatattcacaagaaaatggttgtcgatgtttag

DBGET integrated database retrieval system