KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4209Help
Entry
Dmel_CG4209       CDS       T00030                                 

Gene name
CanB
Definition
Calcineurin B (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dmel_CG4209 (CanB)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dmel_CG4209 (CanB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:4F5-4F5
AA seq 170 aa AA seqDB search
MGNETSLPMDMCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVRGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTICFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagacctccctgcccatggacatgtgttccaacttcgatgcggacgagatc
cgtaggctgggcaagcgattccgcaagctggatctggacaactcgggtgcgctgagcata
gatgagttcatgtcgctgccggaattgcagcagaatccgctggtgcagcgggttatcgat
atcttcgatgcggatggaaacggggaggtggacttcaaggagtttatccagggagtgtcg
cagtttagcgtgcgcggcgataagctgtccaagctgcgattcgccttccgcatctatgat
atggacaatgatggctacatctcgaacggggaactcttccaggtgctcaagatgatggtg
ggcaacaatctgaaggacacacagctgcagcagatcgtggacaagaccatttgctttgcg
gacaaggacgaggatggcaagatatcgttcgatgaattctgctcggtggtgggcaatacc
gatattcacaagaaaatggttgtcgatgtttag

DBGET integrated database retrieval system