KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42320Help
Entry
Dmel_CG42320      CDS       T00030                                 

Gene name
Doa
Definition
(RefSeq) Darkener of apricot (EC:2.7.11.- 2.7.12.1)
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dmel_CG42320 (Doa)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   Dmel_CG42320 (Doa)
Spliceosome [BR:dme03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Dmel_CG42320 (Doa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:98F2-98F2; 3R:3-99 cM
AA seq 832 aa AA seqDB search
MVAANLEVPTSSSSSAATKRQKDVDNKLEKCLNDMLKLKTSSNNNSTSNSNNNAIMSHSL
TGEHKDPKTALEGPTSSSSSSSSKYIGESQIPVPVQLYDPQKPLLQQQQQQQRICYPIGK
SNSTSQLPMGGYQRLLQHQQQQHHQQQQQQHQEQQQYPQHKRPFLNWNSFACSAMNGASD
PFMQQQHMPAHQQQQHLPHKLQQSYSSSHVPKQAPKSGLAMFLQKNTNKENKFGQPMQQQ
PPGMMPQMYGYQAPQQQSKIGYPRTGAPLTHSASFSSAQRPTALQFHQQHQQQQHLQQQQ
QHPQQQQHQHSSFGVGMMSRNYYNMPKQPERKPLQTFDPYAYPKPNQMQPVKYQQQQQHP
HTQFQNASAGGGGGGAAGLQYDPNTNTQLFYASPASSSSNKQPQQPQQQQQQQQSQLQQS
NSVIFNHSGQQHQPHQQQQNEMSKSALGLHFIETAKPVIQDDADGHLIYHTGDILHHRYK
IMATLGEGTFGRVVKVKDMERDYCMALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHL
CVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNR
LTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTR
HYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMA
RNHTLYSKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKML
EYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQPLSSGSSSRERSHSLSR
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atggtggctgccaatttggaggtgccaacatcgtcatcgtcatcagcggccacaaagcgc
cagaaagatgttgacaacaagctagaaaaatgcttgaacgacatgctaaagttgaagacc
agcagcaacaacaacagcactagtaacagcaataataatgcaatcatgtcgcattcgctg
acgggcgagcacaaagacccgaagactgcactcgaaggccccacgagcagcagcagcagc
agcagcagcaagtacataggtgaatctcagatccccgtgccagttcagctgtacgatccg
cagaagccgttgctgcagcaacagcagcagcaacaaaggatctgctatcccataggcaaa
tctaactctacctctcagctacccatgggcggctatcagcgattgctgcaacatcagcag
caacaacatcaccaacagcaacagcagcaacatcaggaacagcagcagtatccgcagcac
aagcgacccttcctcaactggaatagctttgcatgttccgccatgaacggagcgagtgat
cccttcatgcagcagcaacacatgcctgcccaccagcaacagcagcatctgccacacaag
ctgcagcaatcatactcctcgtctcatgtgcccaagcaggcgcccaaatcgggactggcc
atgtttctgcagaagaacaccaacaaggagaacaagtttggccagccgatgcagcagcag
ccacccggcatgatgccccagatgtatggataccaggcgccccagcagcaatccaagata
ggctatccccgcacaggtgccccactgacgcactcggcctccttcagctccgcccaaagg
ccgacggccctgcagttccaccagcaacatcagcagcagcagcatctgcagcaacagcag
caacacccccagcagcaacaacatcagcattccagctttggggtgggcatgatgagtagg
aattactataatatgcccaagcagcccgagcgcaagccgctgcagacctttgatccgtat
gcctatcccaagccgaatcagatgcagccggtcaagtaccagcagcagcaacagcatccg
catacgcagtttcagaatgcttccgctggaggaggcggtggcggtgctgctgggcttcaa
tacgatccaaatacaaatacgcaattgttttacgcgtcgccggcgtcatcgtcatcgaac
aagcaaccgcaacaaccgcaacagcaacagcagcagcagcagtcccagctacaacaaagc
aattctgtcatattcaatcactcgggccagcaacaccaaccacatcaacagcagcagaat
gaaatgtccaagtccgcattggggctgcacttcatcgagacagcaaagcccgtcattcaa
gatgatgctgatggtcacttaatttaccacaccggagacattctccatcacagatataag
atcatggccacactgggcgagggaacttttggacgtgtggtcaaggtcaaagatatggag
cgtgattactgcatggctttaaagattattaagaacgtggaaaagtaccgcgaagctgcc
aagctggaaataaatgctttggaaaagattgcccaaaaggatccgcattgtgatcatttg
tgcgtcaaaatgattgactggtttgattatcatggacacatgtgtatagtttttgaaatg
ttggggctcagtgttttcgattttttgcgagagaacaactatgagccatacccgctggac
caagtgcgccatatggcctatcaattatgctactctgtgaaatttctacatgacaatcgt
ttaacgcacacagatctcaagccggagaacatactcttcgtcgactcggattatacttct
cactataatcataagattaaccgcgaggtgcgccgcgtcaagaatacggacgttcgccta
atcgacttcgggtcggccaccttcgaccacgagcaccacagcacaattgtctcgacgcga
cattaccgcgcgccagaggtcatactggagctggggtggtcacagccgtgtgacgtttgg
tccattgggtgcatcttgttcgaactgtatctgggaatcacgctcttccaaacgcacgac
aatcgcgaacacttggccatgatggagcgaatcttgggacaaataccatatcgcatggca
cgcaatcatactctttatagcaaaaccaaaacaaagtacttctatcatggtaagttagat
tgggatgagaagtccagtgcgggtcgctacgtccgtgatcactgcaagccgttgttcctg
tgccagctgagcgacagcgaggaccactgtgagctcttcagtctgatcaagaagatgctg
gagtacgagccgtcgtcacgcatcacgttaggtgaggccctgcatcatccgttctttgat
aggctgccaccacaccatcgagtaggtgaggtcagcaacaagcagcccctttcgtcgggc
agcagcagccgcgaacgatcgcatagcctctccagatga

DBGET integrated database retrieval system