KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42639Help
Entry
Dmel_CG42639      CDS       T00030                                 

Gene name
proPO-A1
Definition
prophenol oxidase A1 (EC:1.10.3.1 1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:dme00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:dme00740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:54F6-54F6; 2R:2-79.6 cM
AA seq 690 aa AA seqDB search
MTNTDLKALELMFQRPLEPAFTTRDSGKTVLELPDSFYTDRYRNDTEEVGNRFSKDVDLK
IPIQELSNVPSLEFTKKIGLKNQFSLFNNRHREIASELITLFMSAPNLRQFVSLSVYTKD
RVNPVLFQYAYAVAVAHRPDTREVPITNISQIFPSNFVEPSAFRDARQEASVIGESGARV
HVDIPQNYTASDREDEQRLAYFREDIGVNSHHWHWHLVYPTTGPTEVVNKDRRGELFYYM
HHQILARYNVERFCNNLKKVQPLNNLRVEVPEGYFPKILSSTNNRTYPARVTNQKLRDVD
RHDGRVEISDVERWRDRVLAAIDQGYVEDSSGNRIPLDEVRGIDILGNMIEASPVLSINY
NFYGNLHNEGHNIISFAHDPDYRHLEEFGVMGDVTTAMRDPIFYRWHGFIDTVFNKFKTR
LNPYNAGELNFDGITVDYIEAKIGKSNTKANTLLTYWQKSSADLAAGLDFGPTTDRNIFA
SFTHLQNAPFTYTFNVTNNGARRTGTCRIFICPKVDERNQALNLEEQRLLAIEMDKFTVD
LVPGENTIRRQSTESSVAIPFERSFRPVGADYQPKAADELARFKFCGCGWPQHLLLPKGN
AQGMVFDLFVMISDYSQDSVEQPKTPNDACSTAYSFCGLKDKLYPDRRTMGYPFDRRLPN
ANLTELVGAFGNMAKTDLRIVFNDRVIDKA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgactaacacggatctgaaagccttggaacttatgttccagcgacccctggaaccggca
ttcaccactcgtgactccggaaaaactgtattggaactgcccgattccttctatacggat
cgctatcgcaatgacaccgaggaggtgggcaatcgattctctaaggacgtggatctgaag
atcccaattcaggagttgagcaacgttcccagtctggagttcaccaaaaagattggtctc
aagaatcaattttcgctgtttaacaatcgccatcgtgagatcgccagcgagctgatcacc
ctcttcatgagcgcaccaaatctcagacaattcgtgtcgctttccgtttacaccaaggat
cgtgtgaatcctgtgttgttccaatacgcctatgccgtcgccgttgcccatcgcccggat
acgcgtgaagtgcccattaccaacatttcccagatctttccgagcaactttgtagaacct
tccgccttccgggatgcccgtcaggaagcttctgttattggagagagcggcgctcgtgtc
catgtggacattccgcaaaactacacggcctcggatcgcgaggatgaacagcgcctggcg
tacttccgtgaggacatcggtgttaatagccatcattggcactggcacttggtctacccg
accaccggacccacggaggtggtcaacaaggatcgtcgtggcgagctcttctactacatg
caccaccagatactcgcgcgctacaatgtggagcgcttctgcaacaatctgaagaaggtt
cagccgctgaacaatctgcgtgtggaggttcccgagggctacttccccaagatcctgtcc
agcacgaataaccgcacctatcccgcccgagtgaccaaccaaaagctgagggacgtggac
cgccatgatgggcgtgtggagatctccgatgtggagcgctggcgtgatcgcgtgctggct
gccatagatcaaggatacgttgaagattcttctggcaatcgtataccattggacgaagtt
cgtggcatcgatatcctgggcaacatgattgaggcatcgccagtcctatccatcaactat
aatttctatggcaatctacacaacgaggggcacaacataatctcctttgcccacgatccc
gattaccgtcacttggaggaattcggtgtgatgggcgatgtgaccacggccatgagggat
ccaatcttctacaggtggcacggattcatcgacacggtgttcaacaaattcaagactcgc
ctgaacccgtacaatgccggtgagcttaacttcgatggtattaccgtggactacattgag
gccaagattggcaagtccaataccaaggccaacaccctgttgacctactggcagaagtcg
agtgccgacttggcagctggcctggactttggaccaacgaccgatcgcaacatattcgcc
tcgttcacccatctccagaatgcccccttcacttatacattcaatgtgaccaataatgga
gccagacgaacgggtacttgccgtatcttcatctgccccaaggtggatgagcgtaatcag
gctttgaatctggaggagcagcgactgttggccatcgaaatggacaagttcacagttgat
ttggtgcctggtgagaacaccatacgccgccagtcgacagagtcctcggtggccattccc
ttcgagcgctcattccgcccggttggagcagactatcagcccaaggccgccgatgagttg
gcacgcttcaagttttgcggatgtgggtggccacagcatctcctgctgcccaagggcaat
gcccagggaatggtcttcgacctgttcgtcatgatttccgattactcgcaggactccgtt
gagcagcccaaaacacccaacgatgcctgcagcacggcgtactcgttctgtggtctgaag
gacaaattgtatcctgacagacgcaccatgggctatcccttcgataggcgcctgcccaat
gccaatctcaccgaattggtcggtgcctttggcaacatggccaagaccgatttaaggatt
gtcttcaatgatcgtgtgattgacaaggcctag

DBGET integrated database retrieval system