KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42640Help
Entry
Dmel_CG42640      CDS       T00030                                 

Gene name
proPO59
Definition
prophenoloxidase 59
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dmel_CG42640 (proPO59)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Dmel_CG42640 (proPO59)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     Dmel_CG42640 (proPO59)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:59C3-59C3
AA seq 683 aa AA seqDB search
MADKKNLLLLFDHPTEPVFMDKGGNGTVFDVPDSYVTDRYNQMCKKVQRRVSSASEKNVQ
VKEIAIPDLSCSMRLGRSEQFSIFLKSHRKMASHLIEIFTKMQTVDELQSVAVYARDRVN
PVLFNYALSVALLHRPDTKDLELPAFAQTFPDRFIDSKMLRSMREESFVVERSAARLPVV
SSVKYTASDLDVEHRLWYFREDLGVNLHHWHWHLVYPIEAPDRSIVDKDRRGELFYYMHQ
QIIARYNAERLSNHMARVQPFNNLDEPIAEGYFPKMDSLVASRAYPPRFDNTRLSDVDRP
NNQLRVGIDDMKRWRERIYEAIHQGYVLDTNNEKIVLDDAKGIDILGNIIEASDLTPNST
LYGDFHNMGHILIAYSHDPTNKHLEYAGVMGDASTAMRDPIFYKWHAFIDNMFQEHKRLL
SPYEKQELSFPDVRVESIQVESQGQVNRLTTFWQESDVDMSRGLDFVPRGHVLARFTHLQ
HHEFSYTIKVENSSEATRYGYVRIFLAPKLDDRNAPMLLEQQRLMMVELDKFVVTMPPGS
HTITRNSTESSVTIPFERTFRNLDKLEELQNFLCGCGWPQHMLIPKGRPEGLRFELFVMV
SNYEEDKVDQTVADCGCSIAASYCGLRDRLYPDRKSMGFPFDRKPRRGSEILENFLTPNM
CAVEVIITHEDRTEKLREVPARS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaagaagaatctgctccttctgttcgatcatcccacggagcccgtgttcatg
gacaagggtggcaatggcaccgtcttcgacgtgcccgactcctacgtgaccgatcgctac
aatcagatgtgcaagaaggtccagcggcgcgtgagcagcgcgtccgagaagaacgttcaa
gtcaaggagatcgccataccggatctcagttgctccatgagactgggccgctcggagcag
ttctcgatcttcctgaagtcccaccgcaagatggccagccacctgatcgagatcttcacc
aaaatgcagaccgtggatgagctgcagagcgtggcggtgtacgccagggatcgcgtcaat
ccggtgctcttcaactacgccttgtcggtggccctgctccaccgtccggacaccaaggac
ctcgaactgcccgcctttgcgcagaccttcccggatcgctttatcgactcgaagatgctt
cgcagcatgcgcgaggagtcctttgtggtggagcgctccgccgcccgcctgcccgtcgtc
agttcggtcaagtacaccgcctccgatctcgatgtggagcaccggctgtggtacttccgc
gaggacctgggcgtcaacctgcaccactggcactggcatctggtctatcccatagaggcg
cccgaccgcagcatcgtggacaaggaccgtcgtggcgagctgttctactatatgcaccag
cagatcattgcccgctacaatgccgagcggctgagcaaccacatggcccgggtgcagccg
ttcaacaacctggacgaaccaattgccgagggctacttccccaagatggactcgctggtg
gccagtagggcgtatcctccgcgcttcgataacacccggctgagcgatgtggaccggcct
aacaaccagttgagggttggcatcgatgatatgaagcgctggcgcgaacgcatctacgag
gccatccatcagggctacgttttggatacgaacaatgaaaagatcgtgctggatgacgct
aagggcatcgacatcctgggcaacatcatcgaggcttccgatctgacgcccaacagtacg
ctgtacggcgacttccacaacatggggcacatactgattgcctactcacacgatccgacc
aacaagcacctggagtacgcgggcgtgatgggcgacgcctccaccgcgatgcgcgatccg
atcttctacaagtggcacgccttcatcgacaatatgttccaggagcacaaacgtctgctt
tctccctatgagaagcaagagctcagctttccggacgttcgcgtcgagagcatccaggtg
gagagccagggtcaggtcaacaggctgaccaccttctggcaggagtccgatgtggacatg
tcccgtggccttgattttgtgccgcgcggccatgtcctcgctcggttcacccatctgcag
caccacgaattcagctacaccatcaaggtggagaactccagcgaggccacgcggtatggc
tacgtgcgcatcttcctggcgcccaagctggatgatcgcaatgcacccatgctgctggag
caacagcgcctgatgatggtggagctggacaagttcgtggttaccatgcctcccggcagc
catacgatcacccggaactccacggagtcgagtgtcaccattccgttcgagcgcaccttc
cgcaacctggacaagctggaggagctgcagaacttcttgtgcggctgcggttggccccag
cacatgctgattccgaagggtcggcccgagggtctgcgcttcgagctcttcgtcatggtt
tccaactacgaagaggataaggttgaccagacggtcgcagattgcggctgcagcatcgcc
gcttcctactgcggcctgcgcgatcgcctctatccggatcgcaagtccatgggcttcccc
ttcgatcgcaagccgcgtcgaggctccgagatcctggagaacttcctgacgcccaacatg
tgcgccgtggaggtcatcattacccacgaggaccgcaccgagaagcttcgcgaggtacca
gctcgctcctga

DBGET integrated database retrieval system