KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4265Help
Entry
Dmel_CG4265       CDS       T00030                                 

Gene name
Uch
Definition
Ubiquitin carboxy-terminal hydrolase
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG4265 (Uch)
Peptidases [BR:dme01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dmel_CG4265 (Uch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:22D4-22D4
AA seq 227 aa AA seqDB search
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETY
EKHRAEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRGVLKDFLE
KTASLSPEERGRALEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDG
RKSFPIKHGPTSEETFVKDAAKVCKEFMARDPNEVRFTVLALTAAQQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttaacctggacgccacttgaatctaatcccgaggttttgaccaagtacatacataaa
ctgggcgtgtcgccagcctggtcggtaactgacgtcattggattggaagatgacaccttg
gaatggattccgcgtcccgtaaaggcgttcattttgctcttcccgtgcagcgaaacctat
gagaagcaccgcgccgaggagcacgatcggattaaggaggtggaggagcagcatcccgag
gatctcttctacatgcgccagttcacccacaacgcctgtggaaccgtcgccctgatccac
agcgtggccaacaacaaagaagtggacattgaccgcggagtactgaaggacttcctggag
aagacagcttccttgtccccggaggaacgcggacgggccctcgaaaaagacgagaagttc
accgccgatcatgaggccttggctcaagagggccagacgaatgccgccaatcatgagaag
gtgatccaccacttcatcgcactggtgaacaaggagggtactctgtacgagctggatggc
cgcaagtccttcccgatcaagcacggaccgacttcggaggagacttttgtgaaggatgcg
gccaaggtctgcaaggagttcatggctcgcgatcccaacgaagtgcgcttcaccgttttg
gccttgaccgcggcacaacaatag

DBGET integrated database retrieval system