KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42708Help
Entry
Dmel_CG42708      CDS       T00030                                 

Definition
CG42708 gene product from transcript CG42708-RA (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dmel_CG42708
   00330 Arginine and proline metabolism
    Dmel_CG42708
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Dmel_CG42708
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Dmel_CG42708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:49B12-49B12
AA seq 775 aa AA seqDB search
MLKGVPTLAGRNLRLLTTQAQVLVHQRAKASAAEPVEDFDQETDLLKRAKFGHTGKQLQQ
KIINEKNLRAPPLMNLVFANRKLSFYDTSSTPKTKEDNAKLHREQEQRNAEDVLFDMFAS
EETGLISMGKFLAGLKTTGIRRNDPRVRELMDNLKKVHKLNNYETGSSAETQHLNRETFK
AVVAPNIVLIAKAFRQQFVIPDFTSFVKDIEDIYNRCKTNTLGKLADYIPQLARYNPDSW
GLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGPKVVHSYVGQEPSGRNFNEL
VLDQNKKPHNPMINAGAILTCSLMNALVKPDMTSAEIFDYTMSWFKRLSGGEYIGFNNAV
FLSEREAADRNYALGFYMRENKCFPKRTNLKEVMDFYFQCCSMETNCEAMSVIAASLANG
GICPTTEEKVFRPEVIRDVLSIMHSCGTYDYSGQFAFKVGLPAKSGVSGGMMLVIPNVMG
IFAWSPPLDHLGNTVRGLQFCEELVSMFNFHRYDNLKHLSNKKDPRKHRYETKGLSIVNL
LFSAASGDVTALRRHRLSGMDITLADYDGRTALHLAASEGHLECVKFLLEQCHVPHNPKD
RWGNLPVDEAENFGHCHVVEFLRSWAEKADQSSEECKPEAVTSKTQADEVSSSSNSSSSP
GSSPGSSPGSSPGSSPGSSPGSSPGSSPCASLTTGDLLGHNSRNLYEMLKLNSNFTFQEI
CSTSDLETSPTTSPIPTPVESGSRAGSGRSSPVPSDAGSTASAGSSIDDKTKPGL
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaggtgttcccacgctagccggtcgaaaccttcgtctcctgacgacccaggca
caggtgctggtccatcaacgcgccaaagcgtccgccgccgagcccgtcgaggactttgac
caggagacggatcttttgaagcgcgccaagttcggacacacgggcaaacagctgcagcag
aaaataatcaatgagaaaaatctgcgcgctccaccgcttatgaacttggtgtttgccaat
cggaagttgtccttctacgataccagttccactcccaagaccaaagaggataatgccaag
ctccatcgcgagcaggagcagcgaaatgcggaggatgtgctattcgacatgttcgccagc
gaggagacgggcctcatctcgatgggcaagttcctggccgggctaaagaccaccggaatt
cgccggaacgatccgcgagtgcgagaactgatggacaacttgaagaaagtgcacaagcta
aataactacgagacgggttcttcggcggaaactcagcatctcaatcgagagaccttcaag
gctgtggttgcccccaatattgtgctgattgccaaggccttccggcagcagttcgttatt
cccgactttacgagtttcgtcaaggacatcgaggatatttacaatcgctgcaagaccaac
actttgggcaagttggccgactacattccgcagctggctcgctataatcccgattcctgg
ggcctgagcatctgcacgattgatggccagcgcttctccatcggcgatgtggatgtgccc
ttcacactccagagttgcagtaagccgctgacctacgccattgccctggagaaactgggt
cccaaggtcgtgcactcttatgtgggccaggagccgagtggcaggaacttcaacgaactt
gttctggatcagaacaaaaagccacacaatccgatgatcaacgctggtgccattctgacg
tgctccctgatgaacgcccttgtcaagccggacatgacctccgctgagatcttcgactac
accatgtcttggttcaaacggctgtcgggcggagagtatatcggctttaataatgccgta
ttcctgtccgaacgcgaggctgccgatcggaactatgccctgggcttctacatgcgggag
aacaagtgcttccccaagcgcaccaatctcaaggaggtgatggacttttacttccagtgc
tgctccatggagaccaactgcgaggcaatgtccgtaatcgcggccagtttggccaatggt
ggcatctgccccaccaccgaggagaaggtgttccggccggaggtaatccgggatgtgctc
tcgattatgcactcatgcggtacatacgactattccggacagttcgccttcaaggtgggt
ctgccagccaagtctggagtgagtggcggcatgatgctggtcatccccaacgtaatgggc
atctttgcctggtctccgcccttggatcacttaggcaatacagtgagaggactacagttt
tgtgaggagctggtctccatgttcaatttccatcgctacgacaacctgaagcatctgtcc
aacaagaaggatccgcggaagcaccgctacgagaccaagggtctgtccatcgtgaatcta
ctcttttcagctgccagcggcgatgttacagccttgcggcgtcatcgtctctccggaatg
gatatcactctggccgactacgatggtcgcactgccctccatttggctgcgtccgaagga
cacttggagtgcgtcaagttcctgctggaacagtgtcatgtaccacacaaccccaaggat
cgctggggaaatctgcccgtggatgaggcagagaacttcggccactgtcacgtggtggag
ttccttcgctcctgggcggagaaggccgaccagtccagcgaggagtgcaagcccgaggcg
gtgaccagcaagacacaagcggatgaggtcagttcaagttcaaactcaagttcaagtcca
ggttcaagtccaggttcaagtccaggttcaagtccaggttcaagtccaggttcaagtcca
ggttcaagtccaggctcaagtccatgtgcaagtttaacgacgggggaccttttggggcac
aattccagaaatctatatgaaatgctcaagctgaattccaatttcaccttccaggaaatc
tgcagcacaagcgacctggagaccagtccgacaaccagtcccattcccactcccgtggaa
tccggatccagggcaggatcaggacggtccagcccggtgccatcggatgcgggcagcacg
gcgagcgccggaagcagcatcgatgacaaaaccaagccgggactataa

DBGET integrated database retrieval system