KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4302Help
Entry
Dmel_CG4302       CDS       T00030                                 

Definition
(RefSeq) CG4302
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00053  Ascorbate and aldarate metabolism
dme00830  Retinol metabolism
dme00860  Porphyrin and chlorophyll metabolism
dme00980  Metabolism of xenobiotics by cytochrome P450
dme00982  Drug metabolism - cytochrome P450
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG4302
   00053 Ascorbate and aldarate metabolism
    Dmel_CG4302
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG4302
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG4302
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG4302
   00982 Drug metabolism - cytochrome P450
    Dmel_CG4302
   00983 Drug metabolism - other enzymes
    Dmel_CG4302
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG4302
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG4302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT DUF1730 Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 37420
NCBI-ProteinID: NP_611563
FlyBase: FBgn0027073
UniProt: Q9W2J4
Position
2R
AA seq 532 aa AA seqDB search
MSLKSALHIFLLSLVALQQLELGTGSRILAAFFFPGKSHFMMTNAIIRELVKQGHEVTFI
TPFSLAKEKLGSNYKEIVIPQYDFWPEIKEMTNKNTVLEMTDLPTFAFLRMVNVMGIHTT
DFALEQPEIQAVINEKNKIGKYDLLLAEQFFNEGALILGHLYQIPTITISTFGNANHLSQ
LFGVVSPWSYVPHAYMPYTDRMTLWERIGNVAMSAAEDLVREFSYYPGQDAVLKKHFSKL
LDRVPTIKELERNISAILLNSYMPLASSRPMAYNMIPVGGLHIQPPKALPEHLQKFLDGA
THGAIYFSLGSQVRSADLPPEKLKVFLEVFGSLKQRVLWKFEDESLPNLPANVKVQSWLP
QGDILAHPNVKVFIAHGGLFGTQEAVYNGVPILGMPVYCDQHQNINQGKSAEYALGLDYR
KVTVEELRGLLMELIENPKYRNNIKKASRIFRDRPLGAMDTAIYWINYVIEHRGAPHLVA
AGVHLPWYQFYLLDIVGLGLAVILLPIVVLILICRRSSKPKSTPTKKKTKKN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaaagtgctctgcacatatttctcctaagtctggttgctcttcagcaacta
gagttgggtaccggttcccgcatcttggcagcattcttttttcctggcaagagtcacttc
atgatgaccaatgccatcatacgggagctggtgaagcaaggacatgaggttacttttatt
actccgttttccttggccaaggaaaaacttggatcaaattataaggaaattgtgattcct
caatacgatttttggccagaaattaaggagatgaccaataagaacaccgttttggaaatg
acagatttgccaacttttgcattcctgcgaatggtcaatgtgatgggtatccacaccacg
gatttcgcactggaacaaccggagattcaggcagtaatcaatgagaagaacaaaattggc
aaatacgatctgctgctggcggagcagttcttcaacgagggtgccctcatcctgggacac
ttgtaccagatcccaaccataactatttcgacatttggtaatgccaaccaccttagtcag
ctatttggggtagtgtctccttggtcatatgtaccacacgcttatatgccctatacggat
cgcatgactttgtgggaacgcatcggcaatgtggccatgagtgcagccgaggatctcgtc
agagagttctcctactaccccggtcaggatgcggtcttaaagaagcacttctccaagcta
ctcgacagagtaccgaccatcaaagaactcgaacgtaatatctcagccattctgttgaac
agctacatgccactggcatcttcgagaccgatggcatataatatgatcccagtgggcggt
ttgcacattcaaccaccgaaggcactaccggagcatctacaaaaattcctggacggagcc
acacatggtgccatttactttagcttgggttcccaggtgagaagtgccgacttgccgcct
gagaagctcaaagtattcctggaagtctttggcagtctgaagcaacgcgttctctggaaa
ttcgaagatgaatctctgcccaatttgccggctaacgttaaggtgcaaagttggttacct
cagggcgacattctggcgcacccgaatgtcaaggttttcattgcccatggaggactcttc
ggcacccaggaggcggtgtacaatggtgttcccatattgggaatgccagtctactgtgat
cagcatcagaacattaaccagggtaagagtgcagaatatgcactgggactggattaccgg
aaagtcacggtggaggagttgcgaggtctgctgatggaactgattgagaatccaaagtat
aggaataacattaagaaggcctcccggatattccgcgatcgaccactcggtgccatggat
acggccatatattggatcaactatgtgatcgagcaccgaggtgctcctcatctggtggcc
gctggtgtacatctaccctggtaccagttctacctactggacattgtgggtctaggtctc
gctgtgatcctgttgccaatcgtagttctaatcctgatctgccgcaggagctccaagccg
aagagcactccgacgaagaagaagaccaagaagaattag

DBGET integrated database retrieval system