KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4320Help
Entry
Dmel_CG4320       CDS       T00030                                 

Gene name
raptor
Definition
CG4320 gene product from transcript CG4320-RC
Orthology
K07204  
regulatory associated protein of mTOR
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dmel_CG4320 (raptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:5D4-5D4
AA seq 1621 aa AA seqDB search
MTSAVRAKSAAAAVGVAVDESSGSSNGSVADQEVASSKEAVLSVLIRKRYEKYVFAPWDD
PIILIMEQLEHIEHCRSAALGNQVAIGRDPSQDDSLNDLGKVISNMRQDQSLVPIVKHIE
QISDIQASNGQELASLGSLRELIRTIRKEWPRDDSIKLRLKEIQILGMPPARSLCFGERI
RDDRCPLSLQTKRHKERIQAMMYERQPWRIRERMKTASVALVLCLNIGVDPPDVVKIQPC
SRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRNA
KGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAGI
IINSFQPYAKQHEEELGKALAAAQQRGGVQQLVGGSGGAANVAANQVQLTNQMVSYKNCI
HLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPGK
VNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSHD
CTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEILDHNAPYRQLPFFEHQLTAFQVWLD
SESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLLQ
SSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSIV
HNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHEK
LYVLLRDSIPEVRAAAVFALGTFISSVTDRSEEQANNIDRIIAITMLETVGEDMSPLVRM
ELAAALQWMVVLFESQFVAVYLTEHMRGHVSAASFVMCPDPRDLTSSTHSLERHVTIRRG
ASSSSISNMGGASISSGTGSSSNPLGRSKSGSGSSGGRGAAGAAGGTNSIPFQSIFTKLW
LGICNLAQDPFPRVAAIAQEIVEHVRDTALCPIMAAKEATMANASEKCSSLSVSLPPSPN
TRVNYLGGGGAPGGAGATAESPPVGAAASGASHWAQKLRLSGSGACMGAGDPQTILQRKL
RTSSINDETDSGPGYSRGVAGAGTGLGLPSGPRESTHSARSSGSESNHYLEPGHSLTPIV
LTEFIPWAISYFTRPGKERYSSAEGSAEEGRQRFPVDRNSAELRRRRLRFLRNDFVRRHA
GRKHQELIDPYGFDVCVWNRKTQFTPSIVKLLPYEPQIAVAYREKVLVYDFQYNSVRTYG
AESLGGNFTGYSSGYGSGSGSSSSLNGSTPRKSGAHTSGGGGGGFSAAPFARVSSIEFIN
AQDMALNLVAHEDGVVRVWQSSPPASSATSEDTPSKARLVTAWTALGQVNQHNHRQRSVA
SGGSIGKGADASGLSSAAIGSGGIVTAWQQCSQHLVIGGGGCRFIRIWDVERELKLADIP
LGRSETCARVLSPYLPNMRSDVILAGCDDGSVRLFDKRCAPQDAGISVYRRHSAPILHAS
LRANGLVLVSGCTEGRISVADMRGSQSSINPFDVVYEWDAGGDVTAITSHQLEDTVACGN
ASKIVIYSLDGRQQKVLRTNEGFIGPKIGHPTYLYFHPYKAQLAVGFVDNTVAIYSPTPV
L
NT seq 4866 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgccgttcgcgctaagtccgccgctgccgcagtcggcgtcgcagtcgacgaa
agcagcggcagcagcaacggcagcgtcgcggatcaagaggtggcctccagcaaggaggcc
gtcctgagcgtcctaatccgcaagagatacgagaaatatgtattcgccccgtgggacgat
ccgataatcttgataatggagcaactggagcacatcgagcactgtcgatccgccgccttg
gggaaccaggtggccatcggccgggacccatctcaggacgactctctgaacgacctgggt
aaggtgattagcaacatgaggcaggaccaatcactggtaccaatcgtgaagcacatcgag
caaatatccgacattcaggcctccaacggccaggaactggcctccctcggttctttgagg
gagctaatccggactatcagaaaggaatggccccgggacgactctatcaaactgcggttg
aaggaaatacagatcctgggcatgccgcccgctcggagcttatgcttcggcgagcgtatc
cgcgacgacaggtgcccgctctccctgcagactaaaaggcacaaggagcgcatccaggcc
atgatgtacgagagacagccgtggcgcatccgcgagcgcatgaagacggcaagtgtggcc
ctggttctgtgcctcaacatcggcgtggatccgccggacgtggtcaagatccaaccctgc
tcacggctagagtgctggatagatcccagctcggtgtccccgccaaaggccatggaactc
attggaagcaacctgcagatgcagtacgaacgctggcagccaagggcccggtacaagaag
tgcaacgatcccaccgtggatgacgttaagaagctctgcacctccctacgccggaacgcc
aagggggagcgcatactcttccactacaacggacacggagtgcccaagcccacagccaac
ggggagatctgggtgttcaacaagaccttcacgcagtacatccccctgagcatattcgag
cttatcacttggatgtcagcgccctccatctacgtgtatgactgctccaacgccgggatc
atcatcaattcgtttcagccatacgctaaacagcacgaggaagaactagggaaggcgctg
gccgccgcccagcagaggggtggtgtccaacagttagtgggcggctctggtggtgccgcc
aacgtagccgccaaccaggtgcagttaaccaaccagatggtcagttacaagaactgtata
cacctggctgcctgtgctgcaaacgagattcttccgatgaatgcacagctgccggcggat
cttttcaccagctgtctgacaacacccattaacatagcgctcaagtggtacgccatgcaa
gaaaagctgggcatggtaccgcgtattcagagcgaactgatcgacaagattccaggcaag
gtcaacgaccggcgcactatgatgggtgagcttaactggatcttcaccgccattacggac
acgatagcatggaacacacttcctcgcgagctctttcagcgcctgtttcgccaggatctg
ctggtggccagcttgttccgcaatttcctgttggccgagcgcattctgcgaagccacgac
tgcacaccagtttccctgcctgccctgccgccttgttatcgccatccgatgtggaaggcc
tgggatctggtggtagatttggctctacagcagctgccggagattctcgatcacaatgcg
ccgtaccgccagctgccattcttcgagcaccagctcacggccttccaggtttggctggac
agcgaatcggagtcgagaacgccaccggaacagctgcccattgtgctgcaggtcctactg
tcgcaggtgcaccgtctgagggccttggagctgctggctcgctttctggatcttggtccg
tgggccgttaatctcgccctgggcgtgggcatctttccatacgtgcttaaactgctgcag
agttctacgcgcgaactgcgacccgttttggtgttcatttgggccaagatcctggccgtg
gatcccagctgccaggtggatctggtcaaggaatacaagtacttcctctccgtgctgcag
gacacctccgtttccaaggagcaccgtacactgtccgcctttgtattgtcctccatagtg
cacaacttcctgctgggacagacgagcgcgcttcaaggtcccctactgtctatttgcctt
gagcagttgaacgacggaagttggctgctgcgccagtggctagccatctgtctgggcatg
ctgtggcagaactttgagaaggcgcgttggtcgggagcacgcgacctggcgcacgagaag
ctgtacgtactgctgcgggactcgataccggaagtgagagccgctgccgtcttcgcctta
ggcacatttattagctccgtgacggatcgtagcgaggaacaggccaataatatcgatcgc
atcattgccattaccatgctcgaaaccgtcggcgaggatatgtcgccgctggtccgcatg
gagctggccgccgccctgcaatggatggtggtgctcttcgagtcacagttcgtggcagta
tatctaactgaacacatgcgcggtcacgtctccgccgcctcgttcgtgatgtgccccgat
ccccgggatctgacgtcttccacgcacagcctggagcgtcatgtgaccattcgcagggga
gccagctccagctccatatccaacatgggtggtgcgtcaataagctcgggaacaggatca
tccagcaaccctttgggtcgctcgaagagtggttctggcagttcgggtggaagaggagca
gccggagctgcgggtggtactaacagcataccctttcagtcaatctttaccaagctctgg
ctgggcatctgcaatctggcccaggatccgtttcctcgtgtagcggccattgcccaggag
attgttgaacatgtgagggacacggcactgtgtcccatcatggccgcaaaggaagccacc
atggccaatgcctcggagaaatgcagcagtctaagtgttagcctcccgcccagcccaaat
acaagagttaattacttgggcggtggcggtgcaccaggaggagctggcgcgactgcagaa
tcaccgcccgtcggagcagctgcctcgggcgccagtcactgggcacaaaagctacgacta
tcgggcagtggagcctgcatgggtgctggagatcctcaaaccattctgcagcgcaagctg
cgcaccagctccattaacgatgagacggacagcggaccagggtactccagaggagttgcg
ggtgccggaactggtctgggactgcccagtggaccgagggagagcacccattcggcgcgg
agcagcggcagcgagagcaatcattacctggagccaggacacagcctcacgcccattgtc
ctgaccgaattcataccctgggccatttcctatttcacacggcccggcaaggagcgctac
agcagcgccgagggatcggcagaggaggggcgccagcgcttcccagtggaccgaaactca
gcggagctgcgacgcaggaggttgcgcttcctgaggaacgatttcgtacgccgacatgcc
ggccgaaagcaccaggagctgatcgatccgtacggcttcgatgtgtgcgtatggaaccgg
aagacacagttcacgccttccatcgtgaagctgctgccttacgagccgcagattgcagtg
gcctacagggagaaggttctggtgtacgactttcagtacaattcggtacgcacatacggc
gccgagtctcttggcggcaacttcactggctatagttccggttacggatcaggttccgga
tcatcttcatcgctgaatggcagcactccgcgaaagtcgggcgcacatacaagtggagga
ggtggaggtggattttccgccgccccctttgcccgcgttagcagcatcgagtttatcaat
gcccaggatatggcgctcaacttggtggcacacgaagacggagtggtgcgcgtctggcaa
tcctcgccgccggccagctctgccacctccgaggataccccgagcaaagcccgattagtg
acggcttggacagctctgggccaggttaaccaacacaaccaccgtcagcgcagcgtggct
tccggcgggagcattggcaagggcgcggacgcatcgggactgtcgagcgcagcaattggc
tcgggaggcattgtgaccgcatggcagcaatgcagccagcacctcgtgataggcggcggt
ggctgccgatttatccgcatttgggacgtggaaagggaactgaaactggcagatattcca
ttgggtcgcagcgaaacctgcgcccgggtgctgtcaccctacctgcccaacatgcgttcc
gatgtgatcctcgccggctgcgacgacggcagtgtgcgactgtttgacaagcgttgtgcg
ccgcaggacgccgggatctccgtttatcgacgacacagtgcccccatcctccacgccagc
ctgcgggcaaacggactggtgctggtctccggctgcaccgaaggtcggatcagtgtggcg
gacatgcggggaagccagtcctccattaaccccttcgatgttgtgtacgagtgggacgcc
ggtggcgatgtgacggccataaccagccaccagttggaggacacggtggcctgcggcaat
gcctccaagatcgtgatctactcgctggacggacggcagcagaaggtgctgcggacgaac
gagggtttcattggtcccaagatcggtcaccccacgtatctgtattttcacccatacaaa
gcccagcttgcggtgggcttcgtggacaatacagtggccatatacagccccaccccagtt
ctataa

DBGET integrated database retrieval system