KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4347Help
Entry
Dmel_CG4347       CDS       T00030                                 

Gene name
UGP
Definition
CG4347 gene product from transcript CG4347-RE (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG4347 (UGP)
   00052 Galactose metabolism
    Dmel_CG4347 (UGP)
   00500 Starch and sucrose metabolism
    Dmel_CG4347 (UGP)
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG4347 (UGP)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dmel_CG4347 (UGP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67B1-67B2
AA seq 511 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
IEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKT
LENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggccaccagcgtgcaccgtccgactcc
aaggagttccatgaggtgaccaaacgggatgcacttcgtctgctggagcacgatgtggac
cgtctgctggagaccactgagaaggcccgccagcctgccctcaaggcagaaatgggtcgt
ttcgccgatctgttcggacgtttcattcaggaagagggtcccgcattggactggaacaag
attcagaagctgcctgagaatgctgtgatgaactactcgaatcttaagtcgcccaagaac
gagcagatccgcaacatgttggataaattggtggtcatcaagctgaacggtggtttgggc
acctcaatgggttgccatggtcccaagagtgtgattcctgtgcgttcggatcttactttc
ctggatctgaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaatgttccg
ctggtactgatgaactcctttaacaccgacgaggataccgagaagatcgtgcgcaagtac
aaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcattagtcgc
gagcactacctgccggtggccaaagactttgatgtcgaaaaggatatggaagcctggtat
ccacctggacacggtgacttctacgataccttccgcaactctggcctgctgaagaagttc
atcgaggagggccgcgagtattgtttcttgtccaacatcgataacctgggcgccaccgtc
gatctgaacatcctcaataagctggtgggcgaggagcgggccactactccagtggagttt
gtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcattcaaatg
gaaaacaagctgcgcctgttggaaattgctcaagtgccaccagagcatgtggatgacttt
aagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctggcagcc
attgatcgcgttttgcgtgagcgtaccttaaacatggaaattattgtgaacaacaagacg
ctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatgaagtgc
tttgatggcgccatcggcatcaatgtgccgcgttcccgtttcttgcccgtgaagaaatct
tcagatctgctgctggtcatgtcaaatttatatacgcttaagaacggcagcctggtaatg
tcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccacttctcg
aaggtcaaggagttcctgggtcgctttgccaacatcccggacatcattgagctggatcac
ttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcactgtgatc
atcattgctaaccatggcgatcgtatcgatatcccagctggagccattctggagaacaag
attgtatctggcaatatgcgcatcttggaccactaa

DBGET integrated database retrieval system