KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4347Help
Entry
Dmel_CG4347       CDS       T00030                                 

Gene name
UGP
Definition
(RefSeq) UGP, isoform D
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00052  Galactose metabolism
dme00500  Starch and sucrose metabolism
dme00520  Amino sugar and nucleotide sugar metabolism
dme01100  Metabolic pathways
Module
dme_M00361  Nucleotide sugar biosynthesis, eukaryotes
dme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG4347 (UGP)
   00052 Galactose metabolism
    Dmel_CG4347 (UGP)
   00500 Starch and sucrose metabolism
    Dmel_CG4347 (UGP)
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG4347 (UGP)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dmel_CG4347 (UGP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 39065
NCBI-ProteinID: NP_001163399
FlyBase: FBgn0035978
UniProt: A5XCL5
Position
3L
AA seq 511 aa AA seqDB search
MLDVPHEAKVRGHQRAPSDSKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGR
FADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLG
TSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKY
KGFRVQIHTFNQSCFPRISREHYLPVAKDFDVEKDMEAWYPPGHGDFYDTFRNSGLLKKF
IEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQM
ENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKT
LENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVM
SPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVI
IIANHGDRIDIPAGAILENKIVSGNMRILDH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgttccacatgaagctaaggtgcgcggccaccagcgtgcaccgtccgactcc
aaggagttccatgaggtgaccaaacgggatgcacttcgtctgctggagcacgatgtggac
cgtctgctggagaccactgagaaggcccgccagcctgccctcaaggcagaaatgggtcgt
ttcgccgatctgttcggacgtttcattcaggaagagggtcccgcattggactggaacaag
attcagaagctgcctgagaatgctgtgatgaactactcgaatcttaagtcgcccaagaac
gagcagatccgcaacatgttggataaattggtggtcatcaagctgaacggtggtttgggc
acctcaatgggttgccatggtcccaagagtgtgattcctgtgcgttcggatcttactttc
ctggatctgaccgtgcagcaaatcgagcatctcaacaagacctacgatgccaatgttccg
ctggtactgatgaactcctttaacaccgacgaggataccgagaagatcgtgcgcaagtac
aaaggattccgtgtgcagatccacaccttcaaccagagctgcttcccgcgcattagtcgc
gagcactacctgccggtggccaaagactttgatgtcgaaaaggatatggaagcctggtat
ccacctggacacggtgacttctacgataccttccgcaactctggcctgctgaagaagttc
atcgaggagggccgcgagtattgtttcttgtccaacatcgataacctgggcgccaccgtc
gatctgaacatcctcaataagctggtgggcgaggagcgggccactactccagtggagttt
gtcatggaggtcaccgacaagacccgtgctgacgttaagggtggtactctcattcaaatg
gaaaacaagctgcgcctgttggaaattgctcaagtgccaccagagcatgtggatgacttt
aagtcggttaagaccttcaagttctttaacaccaacaacatttgggccaacctggcagcc
attgatcgcgttttgcgtgagcgtaccttaaacatggaaattattgtgaacaacaagacg
ctggagaacggaacccgtgtcattcagctggagactgctgtgggtgcggccatgaagtgc
tttgatggcgccatcggcatcaatgtgccgcgttcccgtttcttgcccgtgaagaaatct
tcagatctgctgctggtcatgtcaaatttatatacgcttaagaacggcagcctggtaatg
tcgccacagcgaatgttccctaccacgccgctcgtcaagctgggagagaaccacttctcg
aaggtcaaggagttcctgggtcgctttgccaacatcccggacatcattgagctggatcac
ttgaccgtgagcggagatgtgactttcggtcgtggcgtttctttgcgcggcactgtgatc
atcattgctaaccatggcgatcgtatcgatatcccagctggagccattctggagaacaag
attgtatctggcaatatgcgcatcttggaccactaa

DBGET integrated database retrieval system