KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4353Help
Entry
Dmel_CG4353       CDS       T00030                                 

Gene name
hep
Definition
hemipterous (EC:2.7.11.- 2.7.11.13)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG4353 (hep)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dmel_CG4353 (hep)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dmel_CG4353 (hep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
X:11D10-11D10
AA seq 1162 aa AA seqDB search
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGARGPVVSGSVPSARVPPLATSASAAT
SATHAPSLGAGSVSGSGISIAQRPAPPVPHATPFGSASASSSSSSASAFASAAPATGTFG
GTYTPPTTRVSRATPTLPMLSSGPGGGLNRTRPVILPLPTPPHPPVSETDMKLKIIMEQT
GKLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRI
LMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVT
VATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAY
MAPERIDPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYG
EGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIYESAKVDVPNWFQSIKDNRLRA
NGDPTLQRATATGSAIGSGAGSLAGSGSGSAGGAVKYGRATTYAGQSPTNPQKTIKPTQI
PSYQQQQSQFFMQSATQLPQTTTTTPTATTNCFGGSGNGNGRGNGSGGSGNGSGSSSSAS
PLSPPSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLT
TSPFSQKKHNSTATTIPLPHNNQTLITDAATAAAAAATATTPPNIAATVLTTTPTTTPTW
RLPTENSQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTLQLTSQQQQQPQRL
QPGNQSPIVLQRFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTHST
SSQSSTQSTCSQIAINPASISPSSGSGTGNMAGLGIGSAPASGLGAAGHFGAGGTGEQLQ
YQPLPIAAEATGTSPTLQSRSPEQQSDYGGNGNMVASKLSKLYARRQLLGQSSSSGASNS
SLDGCSREQHDAATSPVASSMDRDQEPVHPQPPAYRSVVNNGSGGKSYYYRTLSAASSSS
NTSQSTSPTTEPLPGGGTSSFLRRYASSGPGGSISTPPSPHILAGLDRRHRSPDPPPRYN
RGQSPLLLRKNLLELSGQPPGSPLLHRRYVSASPPLPPPRRGSESVPGSPQHFRTRIHYT
PEPQRRIYRTIDQXVALQIMVM
NT seq 3489 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccattgagttcgaaacgatcggcagtcggctgcaatccttggaggcaaagctc
caggcgcagaatgagtcccacgaccagatcgtcctctccggtgcgcgcggccctgtcgtt
tccggttccgttccatctgcccgcgtcccgcccctggcgacatccgcatccgcagccaca
tccgccacccacgcaccttccttgggcgcaggttccgtttccggatcgggtatcagcata
gcccagcgtccagcacctccagttcctcatgcgacgcccttcggcagcgccagcgcctcg
tcatcatcctcatccgcatccgcatttgcatccgcagcaccggcgacgggcaccttcggt
ggaacatacaccccgccgacaactagagtgtcgcgagccacgcccacactgcccatgctt
tctagtggtcccggtggtggactgaatcgtacgcggccggtgatacttccgctgcccacg
ccgccacatcctccagtttcggaaacggacatgaagctgaagatcatcatggagcagacc
ggcaagctgaacatcaacgggcggcagtatccgacggacatcaatgacctcaagcacctg
ggcgacctgggcaatgggactagcggcaatgtggtgaagatgatgcacctgtccagcaac
acgatcatcgccgtgaagcagatgcgacgcactggcaacgcggaggagaacaaacgcatc
ctgatggatctggatgttgtgctcaaatcgcacgactgcaagtacattgtcaagtgcctt
ggctgcttcgttcgcgatccggatgtgtggatctgcatggagctgatgtccatgtgcttt
gacaagctgctcaagctgtccaagaagccggtgccggaacagatcctgggcaaggtcaca
gtggcgacggtcaacgcattgtcctacttgaaggacaagcacggagtcatccatcgagat
gtgaagccctcgaacattctgatcgatgagcgcgggaacatcaagctctgtgatttcggg
atcagcggacgcctggtggactccaaggccaacactcgatccgccggctgtgcagcttat
atggcgccggagcgcatcgaccccaagaaaccaaagtacgacattcgcgcagatgtgtgg
tcactgggcataacgctggtggagctggccacagcgcgatccccgtacgagggatgcaac
acggacttcgaggtgctcaccaaggtgcttgactcggagccgccgtgtttgccatacggc
gagggttacaactttagtcagcagttccgcgatttcgtcatcaagtgcctcacaaagaac
catcaggatcgacccaagtatccggagcttttggcccagcccttcatccggatttatgaa
tcagccaaagtagatgtgcccaattggtttcagagcatcaaggataaccgactgcgcgcc
aatggcgatccaacgctccagagggcaacggcgactggaagtgcgatcggttctggggcc
ggatctctcgcaggatcaggatcaggatccgcaggtggagctgtaaaatatggtagggcg
acaacgtatgcggggcagagtcccacaaatccgcagaagacaataaaacccactcagata
ccgagttaccagcagcaacagtcgcagtttttcatgcaatcagccacacaactacctcaa
acaacaaccacaacaccgacggcaacgacaaactgtttcggcggcagcggaaacggaaat
ggaagaggaaacggcagcggcggaagcggaaatggtagcggaagcagcagcagtgccagt
cctctatcgccaccaagcgccggtatcggcgatcttaaccggctttatcgcaaatcgccg
ttcatgcagcgaaaactgagcaacggatcccatcatccgcactacaaatataacgacgag
agccccaagaaggagtccatgtttagtagcatcggtcaatcgattctacgcaatctgaca
acatcgcccttcagccaaaagaaacacaattcaactgcaacaacaataccactgccgcac
aacaaccaaacattgatcacggatgcagcaacagcagcagcagcggcggcaacagcaaca
acaccgccaaatattgcagctacagtgctcacgacaacgccaacgaccacgcccacttgg
cgcctgccaacggaaaattcccaagcctacgacagctgtgatagtagtagtaatgcgacc
acgacgaccttgaatttgggcctctcctcaccctccccctcgttgccgcgcaagcaattc
cccacagaatcgccgaccctgcaactcacgagtcagcagcagcagcagccacagcgattg
cagccgggcaatcagagccccatagtgctgcagcgcttctaccaccagcagaatcagctg
cgcgagaaggaggcggctgagcggtatcagcagcagcgccagcagccgcccgttggagtg
accagcacgaatccgtttcacagcaactatgtgccgccgccgccatcaacgcactccacc
tctagtcagtcctccacgcagtcgacgtgttcgcaaatcgccatcaatcccgccagcata
tccccatcgtctggttccggaacgggaaacatggcgggattgggaatcggttcggctccg
gcatcgggattgggggcagctggtcactttggagcgggcggcactggcgagcagctgcag
tatcagccgctgcccatcgccgccgaggcaacgggaacgagtcccacgctccagtctaga
tcaccggaacagcagtcggattatggaggaaacggcaacatggtggccagtaagctgagc
aagctgtacgcacgccgacaacttttgggccagagctccagcagcggagcgagcaatagc
agcctggacggttgcagtcgggagcaacacgatgcagccacgtcgccggtggcgtccagc
atggatcgagaccaggagccagtgcatccgcagccgccggcgtacaggagcgttgtgaat
aacggcagcggtggcaagtcttactactatcgcaccttgtcggcggccagcagcagtagc
aataccagccagagcacctcgcccacgacggaaccgctgcccggcggtggcaccagtagc
tttctgcgtcgctatgcaagcagtggaccgggaggtagcatcagcacgccgcccagtccg
catatcttggcgggattggatcgcaggcatcgaagtccagatccgccgccacgctacaat
cgcggacagtcaccgctattgctgcgcaagaatctgctggagctgagtggccagccgccc
ggctctccgctgctgcaccgaagatacgtttcggcttcgccgccgctgccgccaccgcgt
cgaggctctgaaagcgtgccgggatcaccgcagcatttccgcactcgcatccactataca
cccgagccccagagacgcatctaccgtacgatagatcaatgagtagcgctgcaaatcatg
gtcatgtga

DBGET integrated database retrieval system