KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4414Help
Entry
Dmel_CG4414       CDS       T00030                                 

Gene name
Ugt58Fa
Definition
CG4414 gene product from transcript CG4414-RA (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG4414 (Ugt58Fa)
   00053 Ascorbate and aldarate metabolism
    Dmel_CG4414 (Ugt58Fa)
   00500 Starch and sucrose metabolism
    Dmel_CG4414 (Ugt58Fa)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dmel_CG4414 (Ugt58Fa)
   00860 Porphyrin and chlorophyll metabolism
    Dmel_CG4414 (Ugt58Fa)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG4414 (Ugt58Fa)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG4414 (Ugt58Fa)
   00983 Drug metabolism - other enzymes
    Dmel_CG4414 (Ugt58Fa)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Dmel_CG4414 (Ugt58Fa)
Glycosyltransferases [BR:dme01003]
 Others
  Hydrophobic molecule
   Dmel_CG4414 (Ugt58Fa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:58F3-58F3
AA seq 529 aa AA seqDB search
MESQWNRWILLAILGLALGQISQAAKILVLFPHVNEGHFAVMRTLVTELANREHTIEVYT
GHGLGESLDNVTETVTAEFPFWSELQKQAAPKGNLADLGLLPIEKLRQSLASVGARALDH
FLAQEPIQKLLKMSYLEFDFDVILVDYFYTEALLALGALHQRPVVGIISTDFGNYMDAVQ
EALVPAACSPIDFERDQPEMSFSVRLGNIRTCIARRKQFIKDHYGGQEQLVTKYFQLQSS
IPELQASQLSVLLLNSHVPLITPKVSIQQIIPAGGLHIRGPKELPWNVKRFLEEARPGAI
YVQLGNEQACGQLPKEKLDTLFAFFSARKQSIIWTCHDVKTLEGLPKNVMIQHAVPQIDI
LAHPRVKAFLTNGDLLNLQEGIMRNVPILGLPLFQHEARNMELAVRLGVGLQLEEGNVTT
ESLNWAVDRLLLESHFQLTIRDVSLEFRDRPLGALASALFWVNYVARHKGGSALRTRGIG
ISSCQLHLFDLFVFYAGIATLVVSLLVALSFGGFYIWNKKNNSKSTKVN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcaatggaatcgttggatcttgctggctattttgggactagctctgggccag
atttcacaggcagccaagatcctggtactgtttccccatgtcaacgagggtcactttgcg
gtgatgcggactctggtcaccgagttggccaatcgcgagcacacaattgaagtatatacc
ggtcatggtttgggagaatctctggataacgttaccgaaacggtgacagcggaatttcct
ttttggagcgaattgcaaaaacaggcggcacccaagggaaaccttgctgatcttggactc
ctgccaattgaaaaactccgccagtcattggccagcgttggagcgcgtgctttggaccac
ttcctcgcccaagagcccatccaaaagctgctgaagatgtcatatcttgagttcgatttc
gatgtgatccttgtggactacttctacacagaggctttgttggcactgggagctctccat
cagcggccagttgtagggattatttccacggacttcggcaactacatggatgccgtacaa
gaggcactggtaccagccgcttgttcacccatcgattttgagcgggatcaacctgaaatg
agcttctccgtacgattgggaaatattcggacatgtattgctcgccgtaagcagttcatc
aaggatcactacggcggtcaggagcagttggtgaccaagtacttccagctgcagagctct
atccccgagctgcaggccagccagctatccgtgctgctgctcaatagtcatgtgccattg
ataactcccaaagttagtatccaacagataattcccgccggtggacttcacatccgtggt
cccaaggagctgccctggaatgtgaagcgctttctggaggaggcgcgtcctggagccatc
tacgttcaactgggcaatgagcaggcttgtggccagctacccaaggagaaactcgacact
ctgtttgccttcttctccgccagaaagcagagcataatctggacctgtcacgacgtcaag
accctggagggactgccaaagaatgtgatgatccagcatgcagtgccgcagatagacatc
ctggcgcatccgagagtcaaggctttcctaaccaatggagatctgctcaacctgcaggag
ggcatcatgcggaatgtgcccattctgggattgcccctattccagcatgaagctcggaac
atggagctagccgtgcgattaggagttggcctacagctggaggagggcaatgtgacaact
gagtcactaaactgggcagtggacaggctactcctcgagtcacacttccagttgaccatc
cgggatgtgtctctggagttcagggaccgtcctcttggcgctctggccagcgctctcttc
tgggtgaactatgtggcccggcacaagggaggatcggctttgagaacccgaggcattggg
atctcctcctgccagctgcacctgttcgacctcttcgtgttctatgccggaatagctact
ttagtcgtaagcttactggtggccctgagttttggcggcttttatatttggaataagaaa
aacaactccaagtcgaccaaagtaaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system