KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4421Help
Entry
Dmel_CG4421       CDS       T00030                                 

Gene name
GstD8
Definition
Glutathione S transferase D8 (EC:1.11.1.9 2.5.1.18)
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG4421 (GstD8)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Dmel_CG4421 (GstD8)
   00982 Drug metabolism - cytochrome P450
    Dmel_CG4421 (GstD8)
Enzymes [BR:dme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Dmel_CG4421 (GstD8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3R:87B8-87B8
AA seq 212 aa AA seqDB search
MDFYYHPCSAPCRSVIMTAKALGVDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGF
SIWESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRLYFDMGTLFQSFVEAIYPQIRNNH
PADPEAMQKVDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDIAQYPNVA
RWYENAKEVTPGWEENWDGVQLIKKLVQERNE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacttttactaccatccttgctcggctccttgccgctccgttataatgacagccaag
gcccttggagttgacctgaatatgaagctattgaaggtcatggacggggagcaactgaag
ccggagtttgtgaagctcaatccacagcactgcattcccaccctggtggacgatggcttc
tccatctgggaatcccgtgccattttgatttacttggtggagaagtacggcgctgatgac
tcgctgtatcccagcgatccccagaagaaggctgtggtcaatcagaggctctacttcgac
atgggcaccctgtttcagagtttcgtcgaggccatctatccacagataaggaataatcat
cccgccgatccagaggccatgcagaaagtggacagcgcctttggccacctggacaccttc
ctggaggaccaggagtatgtggctggcgactgcctcaccattgccgacattgccctgttg
gcctccgtttccacctttgaggtggtggacttcgatatagcccagtatccaaatgtggcc
aggtggtacgagaatgccaaggaagtgactcccggttgggaagagaactgggacggtgta
cagctaatcaagaaacttgtccaggagaggaatgaatga

DBGET integrated database retrieval system