KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4466Help
Entry
Dmel_CG4466       CDS       T00030                                 

Gene name
Hsp27
Definition
(RefSeq) heat shock protein 27, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: HSP20
Motif
Other DBs
NCBI-GeneID: 39078
NCBI-ProteinID: NP_001287001
FlyBase: FBgn0001226
UniProt: P02518 X2JC82
Position
3L
AA seq 213 aa AA seqDB search
MSIIPLLHLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPY
ERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHE
EREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQ
QTGPAHLSVKAPAPEAGDGKAENGSGEKMETSK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattataccactgctgcacttggcccgggagttggatcatgactaccgcaccgac
tgggggcatttgctggaggatgacttcggttttggcgtccatgcccacgatctgttccat
ccgcgtcgcctgctactgcccaacaccctgggactgggtcgtcgtcgttattcgccgtac
gagaggagccatggccaccacaatcaaatgtcacgtcgcgcgtcggggggtccaaacgct
ctgctgcccgccgtgggcaaagatggcttccaggtgtgcatggatgtgtcgcagttcaag
cccaacgagctgaccgtcaaggtggtggacaacaccgtggtggtagaggggaagcacgag
gagcgcgaggacggccatggaatgatccagcgtcactttgtgcgcaagtataccctgccc
aagggctttgaccccaacgaggtagtgtccactgtctcatccgacggtgtgctgaccctc
aaggccccgccgccgcccagcaaggaacaggccaagtcggagcgcattgtccagatccag
caaacggggcctgcccatttgagcgtcaaggcaccggcacccgaggctggcgatggaaaa
gccgaaaatggcagcggcgagaaaatggagactagcaagtaa

DBGET integrated database retrieval system