KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4466Help
Entry
Dmel_CG4466       CDS       T00030                                 

Gene name
Hsp27
Definition
Heat shock protein 27
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
3L:67B3-67B3
AA seq 213 aa AA seqDB search
MSIIPLLHLARELDHDYRTDWGHLLEDDFGFGVHAHDLFHPRRLLLPNTLGLGRRRYSPY
ERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTVKVVDNTVVVEGKHE
EREDGHGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQ
QTGPAHLSVKAPAPEAGDGKAENGSGEKMETSK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattataccactgctgcacttggcccgggagttggatcatgactaccgcaccgac
tgggggcatttgctggaggatgacttcggttttggcgtccatgcccacgatctgttccat
ccgcgtcgcctgctactgcccaacaccctgggactgggtcgtcgtcgttattcgccgtac
gagaggagccatggccaccacaatcaaatgtcacgtcgcgcgtcggggggtccaaacgct
ctgctgcccgccgtgggcaaagatggcttccaggtgtgcatggatgtgtcgcagttcaag
cccaacgagctgaccgtcaaggtggtggacaacaccgtggtggtagaggggaagcacgag
gagcgcgaggacggccatggaatgatccagcgtcactttgtgcgcaagtataccctgccc
aagggctttgaccccaacgaggtagtgtccactgtctcatccgacggtgtgctgaccctc
aaggccccgccgccgcccagcaaggaacaggccaagtcggagcgcattgtccagatccag
caaacggggcctgcccatttgagcgtcaaggcaccggcacccgaggctggcgatggaaaa
gccgaaaatggcagcggcgagaaaatggagactagcaagtaa

DBGET integrated database retrieval system