KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4531Help
Entry
Dmel_CG4531       CDS       T00030                                 

Gene name
aos
Definition
(RefSeq) argos
  KO
K02104  protein giant-lens (argos)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04320  Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG4531 (aos)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG4531 (aos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Argos
Motif
Other DBs
NCBI-GeneID: 39833
NCBI-ProteinID: NP_524107
FlyBase: FBgn0004569
UniProt: Q00805
Structure
PDB: 

Jmol
Position
3L
AA seq 444 aa AA seqDB search
MPTTLMLLPCMLLLLLTAAAVAVGGTRLPLEVFEITPTTSTADKHKSLQYTVVYDAKDIS
GAAAATGVASSTVKPATEQLTVVSISSTAAAEKDLAESRRHARQMLQKQQQHRSIIGGKH
GDRDVRILYQVGDSEEDLPVCAPNAVCSKIDLYETPWIERQCRCPESNRMPNNVIIHHHS
HSSGSVDSLKYRNYYEREKMMQHKRMLLGEFQDKKFESLHMKKLMQKLGAVYEDDLDHLD
QSPDYNDALPYAEVQDNEFPRGSAHMRHSGHRGSKEPATTFIGGCPSSLGVEDGHTIADK
TRHYKMCQPVHKLPVCTHFRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNG
SPGYRYLFACSPLTRLRCQRKQPCKLFTVRKRQEFLDEVNINSLCQCPKGHRCPSHHTQS
GVIAGESFLEDNIQTYSGYCMAND
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgacattgatgttgctgccgtgcatgctgctgttgctgctgaccgccgctgcc
gttgctgtcggcggcacgcgactgccgctcgaggtgttcgagattacgccgaccacatcc
acagcggacaagcacaagagtctgcagtacaccgtcgtctacgatgccaaagatatttca
ggagcagcggcagcaactggagtggcgagcagtacagtgaagcccgccaccgagcaactg
accgttgtgagcatttcctccacagcggctgcggagaaggatctcgccgagtcgcggcga
catgcgcgacaaatgttgcagaaacaacagcagcatcgcagcatcatcggcggcaagcac
ggcgatcgggatgtgcgcatcctctaccaagtgggggactctgaggaggatttgcccgtc
tgtgcaccgaatgcagtttgttccaagatcgatctatacgaaaccccatggatcgagcga
caatgtcgttgtcctgaatcgaatcgcatgcccaacaatgtgatcatccatcatcacagt
cattcctcgggatcggtggattccctgaagtacaggaactactacgaaagggagaagatg
atgcagcacaagcgaatgctgttgggtgaatttcaggataagaaattcgaaagtctgcat
atgaagaagctgatgcagaaactgggcgccgtctacgaggatgatttggatcatctggac
cagtcgccggactataatgacgccctgccctatgcggaggtgcaggacaatgagtttccc
aggggatcggcgcacatgaggcattccgggcaccgaggatccaaagagcctgcaaccaca
ttcattggcggctgtcccagcagtttgggcgttgaagatggccacaccattgccgataag
actaggcattacaaaatgtgccagccggtgcataagttgccagtttgcacacacttccgt
gactacacttggactttgacaacagcagccgagttgaatgtgacggagcagatagtccat
tgtcggtgtccccggaattcggtgacatacttgaccaagagggaacccattggcaatggc
agtccaggctacagatatctgtttgcctgctctcccctgacgcgtcttcgctgtcagcga
aagcaaccgtgcaaattgttcacggtgcgaaagcgccaggagttcctggacgaggtcaac
attaactcgttgtgccagtgccccaaaggacaccgctgtcccagtcatcacacgcaatcc
ggcgtgatagccggcgagagttttctggaggacaacatacagacatattccggttactgc
atggccaacgattga

DBGET integrated database retrieval system