KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4531Help
Entry
Dmel_CG4531       CDS       T00030                                 

Gene name
aos
Definition
argos
Orthology
K02104  
giant-lens protein precursor (argos protein)
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:dme00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dmel_CG4531 (aos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Structure
PDB: 

Jmol
Position
3L:73A2-73A2
AA seq 444 aa AA seqDB search
MPTTLMLLPCMLLLLLTAAAVAVGGTRLPLEVFEITPTTSTADKHKSLQYTVVYDAKDIS
GAAAATGVASSTVKPATEQLTVVSISSTAAAEKDLAESRRHARQMLQKQQQHRSIIGGKH
GDRDVRILYQVGDSEEDLPVCAPNAVCSKIDLYETPWIERQCRCPESNRMPNNVIIHHHS
HSSGSVDSLKYRNYYEREKMMQHKRMLLGEFQDKKFESLHMKKLMQKLGAVYEDDLDHLD
QSPDYNDALPYAEVQDNEFPRGSAHMRHSGHRGSKEPATTFIGGCPSSLGVEDGHTIADK
TRHYKMCQPVHKLPVCTHFRDYTWTLTTAAELNVTEQIVHCRCPRNSVTYLTKREPIGNG
SPGYRYLFACSPLTRLRCQRKQPCKLFTVRKRQEFLDEVNINSLCQCPKGHRCPSHHTQS
GVIAGESFLEDNIQTYSGYCMAND
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcctacgacattgatgttgctgccgtgcatgctgctgttgctgctgaccgccgctgcc
gttgctgtcggcggcacgcgactgccgctcgaggtgttcgagattacgccgaccacatcc
acagcggacaagcacaagagtctgcagtacaccgtcgtctacgatgccaaagatatttca
ggagcagcggcagcaactggagtggcgagcagtacagtgaagcccgccaccgagcaactg
accgttgtgagcatttcctccacagcggctgcggagaaggatctcgccgagtcgcggcga
catgcgcgacaaatgttgcagaaacaacagcagcatcgcagcatcatcggcggcaagcac
ggcgatcgggatgtgcgcatcctctaccaagtgggggactctgaggaggatttgcccgtc
tgtgcaccgaatgcagtttgttccaagatcgatctatacgaaaccccatggatcgagcga
caatgtcgttgtcctgaatcgaatcgcatgcccaacaatgtgatcatccatcatcacagt
cattcctcgggatcggtggattccctgaagtacaggaactactacgaaagggagaagatg
atgcagcacaagcgaatgctgttgggtgaatttcaggataagaaattcgaaagtctgcat
atgaagaagctgatgcagaaactgggcgccgtctacgaggatgatttggatcatctggac
cagtcgccggactataatgacgccctgccctatgcggaggtgcaggacaatgagtttccc
aggggatcggcgcacatgaggcattccgggcaccgaggatccaaagagcctgcaaccaca
ttcattggcggctgtcccagcagtttgggcgttgaagatggccacaccattgccgataag
actaggcattacaaaatgtgccagccggtgcataagttgccagtttgcacacacttccgt
gactacacttggactttgacaacagcagccgagttgaatgtgacggagcagatagtccat
tgtcggtgtccccggaattcggtgacatacttgaccaagagggaacccattggcaatggc
agtccaggctacagatatctgtttgcctgctctcccctgacgcgtcttcgctgtcagcga
aagcaaccgtgcaaattgttcacggtgcgaaagcgccaggagttcctggacgaggtcaac
attaactcgttgtgccagtgccccaaaggacaccgctgtcccagtcatcacacgcaatcc
ggcgtgatagccggcgagagttttctggaggacaacatacagacatattccggttactgc
atggccaacgattga

DBGET integrated database retrieval system