KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4551Help
Entry
Dmel_CG4551       CDS       T00030                                 

Gene name
smi35A, Dyrk2
Definition
Dual-specificity tyrosine phosphorylation-regulated kinase 2 (EC:2.-.-.- 2.7.10.- 2.7.11.-)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dmel_CG4551 (smi35A)
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dmel_CG4551 (smi35A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:35A1-35A2
AA seq 722 aa AA seqDB search
MLDRCEMPIQLDNEKLRRDVRLSGSRLDLPQLCNGSRRLDGHNNHVAANENTVTTTSLNG
NGNGNGNSNSNNNNNIGSPVSSSTTNSSNGGNERGSSTKSNSSSGSGSSGNSASSTGSGE
LKCNTPMTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYD
DDNGNYKIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAV
VELNILDELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSL
IRRFCNSIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQ
SRFYRSPEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKV
LISVARRRRLFFDSRDAPRCITNTKGRKRSPGSKSLAHILHCQDRYFIDFLQRCLEWDPA
ERMTPDEAAHHEFLQPSASSRHRSCRMSSSSSSSGLNSVSQKSSCYSFSEISPGTNGPVV
ASITSTTAVHNAAIATTTKSRQQPPSQSHGHAQSNGHLPDIKLSASDKYNSMQKVAVRSK
ITSSVSDLESVQQYSLHRIYGGVGSGSTHHVSSAATRKHLPGTGSGIVGAMSSKYGSSTL
AHNHHNVTHHNASTATIATTTHHHHHHGGQQQQQSSSGASTMAMSHSQSTGDVSDRAIFG
RA
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcgatgcgaaatgccgatccagctggacaacgagaagttgcggcgggatgtt
cgattgtcgggctctcgacttgatttgccacaactctgtaatggatcccgtcggttggat
ggccacaacaaccatgtggctgccaatgagaacacggttacaacgacatccctgaatgga
aatggcaacggcaatggcaatagcaatagcaacaacaacaacaacatcggatcgcccgtc
tcctcatcgacaacaaacagcagtaatggcggcaacgagcgcggctcctccacaaagtcc
aatagcagcagtggaagtggcagctcgggaaactcggccagcagcacgggaagtggcgag
ctcaaatgcaatacgcccatgacgccatctgagctggtgaagaagttccgcaactaccta
accgatcttgagttcgaagagctcaaggtgtacaaggaagtgtggtattttggccagcac
gccagcaagaactacaacaaacccgcccccacagccaataccacaaatctgggctatgac
gatgataatggcaactacaagatcatcgaacacgatcacatagcttttcgttacgagatt
ctggaggtaattggcaagggcagttttggccaggtcatcagggcgctggatcacaagacc
aacacacacgtggccatcaagatcataaggaacaagaagcgcttcctcaaccaggccgtc
gtcgaactgaatatcctcgatgagctgcgcgaaaaggacgcggatggatctcataatgtc
atacacatgctcgactatacatatttccgcaagcatttgtgtattacttttgagctaatg
agcttgaacctgtacgaattgataaagaagaacaactacaatggattcagcatgagtctc
atacgacgcttctgcaactcgattgtgaagtgcctgcgtttgctctataaggaaaacatt
attcactgtgatctcaagccggaaaatatcttgctcaaacagcgtggtagcagctccatt
aaagttatcgactttggcagctcatgctacgtggatcgcaaaatctatacgtacatccaa
tcgaggttctatcgctccccggaggtgattctcggcctgcaatacggcacagccatcgat
atgtggagcttgggctgcattctggccgagctgtacacaggattcccgctcttccctggc
gaaaatgaagtggagcagttagcctgcatcatggaggtgctcggtttgccgcctaaggtg
ctcatatcggttgccaggcgacgtcggctgttctttgattcccgtgatgccccgcgctgc
ataactaacaccaagggacgcaaacggtcgccaggcagcaagtcgctggcacatatcttg
cactgccaggaccgctatttcatcgacttcctgcagcgttgcttggagtgggatcctgcg
gagcggatgacgccggacgaggcggcccaccacgagtttctgcagccatctgcctccagt
cgccatcgcagctgccgcatgtcgagcagttcgtccagttccggactcaacagtgtttcc
cagaagtcttcctgctacagcttttcggagatctcgccgggcaccaacggtcccgtggtg
gcctcgatcaccagcaccacggcggtgcacaatgccgcgattgctaccacaaccaagtcg
agacagcagccgccatctcagagtcacggccatgcccaatcgaatggacacctgcccgac
atcaagttaagtgccagcgataagtacaatagcatgcagaaggtggcggtgcgctcgaag
atcacgtccagcgtctcggatctggagtccgtgcagcagtactcactgcaccgcatctac
ggaggagtgggtagtggcagcacacaccatgtctcgtcagcggccaccaggaaacatttg
cccggtacaggcagtggaattgtgggtgccatgtcttccaaatacggcagctcaacgttg
gcgcacaaccatcacaatgtgacgcaccacaatgcatcgactgccaccattgcaacgacc
acgcaccaccatcaccaccatggtgggcagcagcaacagcagtcgtcgtcgggagcatcc
accatggccatgtcgcactcacagtccactggagatgtttccgacagggccatctttggg
agagcttga

DBGET integrated database retrieval system