KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4582Help
Entry
Dmel_CG4582       CDS       T00030                                 

Definition
(RefSeq) CG4582
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
FlyBase: 
UniProt: 
Position
3R
AA seq 432 aa AA seqDB search
MMMRMRNRGGKRLQANYFDTQMPLLSSGLMSPGQLPILDEQHGRQEQLERHYLAHGPSSV
EQQLLRLQPDYKLLYSAEHHTYFHLHTLVPQDNANRQTGPLKSEKESPHRRLFQQVVGNT
LTAAFGLNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM
YNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF
EDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVL
HTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHECSHWRAFMLFAESLARDQATGFLSQGC
PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQNAS
SKRAAHIQENKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcggatgagaaatcggggcggtaagcggttgcaggcaaactactttgacaca
caaatgccactgctgtcgtctggcctaatgagtcccggccagctgccaatattggatgag
cagcatgggcggcaggagcaattggagaggcattacttggcccacgggcccagttcggtt
gaacagcaattactccgcctgcagccggactacaaattgctgtacagtgccgagcaccac
acctacttccacctgcataccctggtcccgcaggacaatgccaaccgccagacaggacca
ttgaaatccgagaaggaatcgccacatcgccggctattccagcaggttgtgggcaacacg
ctgaccgccgcctttggcctaaacgtgatgaacaagggggaccaggaacagaaccagcag
ttcaccagcgaaccggtgaatctctacgatgccgcctcgttgcgccggtctcgcttcagt
cccttcaatcccaccagaatcctcattcacggctggttgggtaatgaaaatgctaacatg
tacaacgagctattgccagcttactttgatctgagaaatggcaactacaacatcttcact
gtggactggggacgtggagccatagcggactacataacggccagctatagggtcaagccg
gtgggtcaggttttggccaagttcgtggacttcctgcatcaggaggcgggaatgcgtttc
gaggatcttcagctcgtcggattcagcatgggcgcacatgtggcgggactggcaggcaaa
catttgcagaccggtcgccttcggatgatccgagctttggatccggctctacccttcttt
cggtatgccaaaccaaaggagcggctgaccgccgaggatgccgactatgtggaggtgctg
cacaccagtgtgggcagctatggatttgatcgacccgtgggtcatgtggatttctatgcc
aactggggcagccagcaaccaggttgcttttggcatgaatgcagccattggagggcattt
atgctgtttgccgagagtctggcaagggatcaggcaacgggcttcttatcccagggctgt
ccagctgctgaatggcagcagttgacccgattccatcgctgcccaaaggacaccggagtt
atgcagaccatgggcggggatttggccaacgtgtcggcggagttcttggcccaaagacag
ggtgtctattatttccaaacaaacgaccagccaccctatgttttagcgcaaaatgcaagc
tcgaaaagggcggcacacatacaagagaacaagaaataa

DBGET integrated database retrieval system