KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4839Help
Entry
Dmel_CG4839       CDS       T00030                                 

Definition
CG4839 gene product from transcript CG4839-RA (EC:2.7.11.- 2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     Dmel_CG4839
Protein kinases [BR:dme01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   Dmel_CG4839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:31A3-31A3
AA seq 1003 aa AA seqDB search
MACFPRLFHNRSKNKFTPAEDENTDTILNTQDSNVQIGKYIRREEKPLYSPIVTPSASEA
KLQRLRQQQQPPGSPPAPARWTLHSVAENGSANNGVQERKFRTNKDKLQAQDACPSGGSA
INVIRSSSKLKPVKERRPTALPTEVPSIEIEDVRDAKDTGDGMDSLGERVQPGANAHVDV
VDGGGKSKLKVNVNGIIDESVAHDDDYDTPSSNSIATTPVTEGPVKFFIGHTQELSAQQT
DDTLSCQSSDANNNSAAKLTNGVVPQEQPEREMGKQQALQAPPRAKSSSNVSLNYLAKSQ
TDSQRRRRVSTMPDINIPPAPPLPPELLVPGTPLHLRKKRSMERQQQQKQQEQQQQQEIQ
QDATNSQDQMAGAEESHKSSDSSTPKTHRVEGGLIYVRPNFPIQSDIEIESIAKDEGTRN
LIRTAIERNDFLNNLMDKERKEMVINAMAPASYRKHSLIIREHEEGSEIYVSAEGQYDVI
RGGQLVASFGPATVFGELAILYNAPRQASIEAATDARVWKIARETFRAIMQISGSREREE
NLQFLRSAPFLQEFDQSLLLKVVDLLQRKFYETDSCIVREGELGNEFYIIRCGTVTIKKL
DEQQQEQIVANRKRGDYFGEQALLNADVRQASVYADAPGTEVLMLDREAFISYLGTIKQL
REKPSSQRNDTSGRSSTKSLEFDNEYSQVAISELKKIATLGCGAFGRVDLVAYNQQALAL
KIIKKIEVVKQDQIEHVYNEKNVMIKCRQSPFIVQLYRTYRNDKYVYFLMEACMGGDVWT
VMSKRQYFDEKTAKFIAGCVVEAFDYLHSHHFIYRDLKPENLMLGTDGYCKLVDFGFAKF
VRQNEKTNTFAGTPEYVAPEIILDRGHDRAVDYWALGILVYELLVGKTPFRGVNQIKIYQ
QILSGIDVIHMPSRIPKSAQHLVRHLCKQLPAERLGYQRKGIADIKRHSWFESLDWQRLK
LKQLPSPIKRPLKSWTDLQYFGPSGVENDYEPPEELSGWDKDF
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atggcctgctttccacgacttttccacaatcgcagcaaaaacaaattcacgcccgccgaa
gatgagaacaccgatacgatactcaacacacaagatagtaacgtgcaaattggcaagtac
atccgtcgcgaggagaagccactgtactcgcccatcgtcactccgagtgccagtgaggcc
aaacttcagcgcctcagacagcaacagcagccgcccggctcaccgcccgcacccgccagg
tggaccctgcactcggttgccgaaaatggcagcgcaaacaatggcgtccaggagcggaag
ttccgcaccaacaaggacaaactgcaggcgcaggatgcatgcccatccggcggcagtgca
attaatgtcatacgctcaagttcgaaattaaaaccagtcaaagagcgacggcccaccgcc
ttgcccaccgaagtgcccagcatcgagatcgaggatgttcgggatgcaaaggacactgga
gatggcatggattcactgggggagcgggtgcagccgggtgctaatgcacatgtcgatgtc
gtcgatggcggcggcaagtcaaaactcaaagtgaatgtgaatggcataattgatgagagc
gtcgcccacgacgatgactatgacacaccctcgagcaactccatagccacaacacctgtg
accgagggtcctgtaaagtttttcattggtcacacgcaggaactaagcgcccagcaaacg
gatgacaccttgtcctgccagagtagcgatgccaacaacaacagtgccgccaaactgaca
aatggcgtcgtgccacaggagcaaccggaacgggaaatgggcaagcagcaagcactccag
gctccgccccgcgccaagagctccagcaatgtgtcactcaattatctggccaagagccag
acggacagccagcgtcgccgacgtgtgtccacgatgcccgatattaacataccgccagca
ccgccgttgccgccggaactcctcgtccccggaacgccgctccatctgcgcaagaaacgg
agcatggagcgacagcagcagcagaagcaacaggagcagcagcagcagcaggagatccag
caggatgctacgaatagtcaagatcaaatggcaggagctgaggagagtcacaagtccagc
gattcctcgacaccgaaaacccatcgcgttgaaggtggcctcatctatgtccgtcccaat
tttcccattcagagcgacattgaaatcgaatctattgcaaaggacgaaggcacacgcaat
ctcatacgaacggccattgagcgcaatgatttcctcaataatctaatggacaaggagcgc
aaggagatggttatcaatgcaatggcaccggccagctacaggaagcacagcctcatcatt
cgtgagcacgaggagggttccgagatatatgtctccgccgagggacagtacgatgtcatc
cgtggtggccaactggtggccagctttggaccggccactgtgttcggcgagctggccatt
ctctacaatgctccacgccaggcgtccatagaggctgccaccgatgcacgcgtttggaaa
atcgcacgcgaaaccttccgggccatcatgcaaatctcggggtccagggagcgcgaggag
aaccttcagttcctgcgctccgctccattcctgcaggagttcgaccaaagtttgttgctc
aaagtcgttgatcttttgcagcggaaattctacgaaaccgacagctgtatcgttcgcgaa
ggtgagctgggcaacgagttctacatcatccggtgcggaactgtgaccataaagaagctg
gacgaacagcagcaggagcagattgtggcgaatcgaaagcgaggtgactacttcggggag
caggcactgctcaatgcggatgtgcgacaggccagtgtctatgcggatgcaccgggcaca
gaggtcctaatgctggacagagaagccttcattagctatttgggaaccataaagcagctg
cgcgagaagcccagtagtcagcgcaacgatacgagtggtcgttccagcaccaagtctctg
gagttcgacaacgagtactcccaggtggccatctcggagctaaagaagatagccacgctg
ggctgcggcgcctttggacgtgtggatctggtggcctacaaccagcaggcgttggctttg
aagattatcaagaaaatcgaggtggtcaagcaagatcaaatagagcacgtttacaacgag
aagaacgttatgatcaagtgccgccaatcgccatttatagtacaactatatcgcacgtac
cgcaatgacaaatacgtttacttcctaatggaggcctgcatgggcggtgatgtatggacg
gtgatgtcaaagcggcagtacttcgatgagaagaccgccaaatttatagcgggctgtgtc
gtcgaggcattcgattacttgcactcccatcacttcatctacagggacttgaagccagag
aatctgatgctgggcaccgatggctattgcaaactggttgattttggatttgccaaattt
gtgcggcagaatgagaagaccaacacatttgctggcacaccggagtacgtggcacccgag
ataatcttggatcgcggacacgatcgtgccgtcgactattgggcactgggaatactggta
tatgaacttctggttggcaaaacacccttcaggggcgttaaccagatcaagatctatcag
caaatccttagcggcatcgatgtcatccacatgccatcgcgcattcccaaatccgcacag
cacctggtgcggcatctttgcaagcaactgccggcggaaagactgggatatcagcgcaag
ggaattgcggatattaagcggcatagttggttcgaaagtctcgactggcagagactgaaa
ctgaagcaattgccatcgcccatcaaaagaccattgaagagttggaccgacttgcaatat
tttggtccttcgggtgttgagaacgactatgagccaccggaggaactgagcggatgggat
aaagacttttaa

DBGET integrated database retrieval system