KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4851Help
Entry
Dmel_CG4851       CDS       T00030                                 

Gene name
Ppt2
Definition
Palmitoyl-protein Thioesterase 2 (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dmel_CG4851 (Ppt2)
  Lipid metabolism
   00062 Fatty acid elongation
    Dmel_CG4851 (Ppt2)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dmel_CG4851 (Ppt2)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dmel_CG4851 (Ppt2)
Lipid biosynthesis proteins [BR:dme01004]
 Fatty acid synthase
  Component type
   Dmel_CG4851 (Ppt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2L:32E2-32E2
AA seq 288 aa AA seqDB search
MRLRLQVLVALLTCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCDK
FNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTFI
SLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSEF
LPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIRR
PIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcgtttgcaagtcctggtggccctgttaacctgctcgtccatttccgtctca
ctggcctacaaaccggtggtcatactccatggaattctatcaggagccgaatcgatggcc
tctctggtccgggaaatcgaagagtttcatcctggcactatcgtctacaactgcgacaag
ttcaatggatggtacagcttggagaacgcctggcgacaggtcgatcaggttagggattat
ctcaacgaggtgggcaaactgcatccagagggcatcattgtgctgggatactcacaagga
ggccttttggcccgggcggccatccaaagtctgcccgagcacaatgtgaagacctttata
tctctatcctcgccacaggcggggcaatacggcactagcttcttgcatctaatctttccc
gacttggcggccaagacagccttcgaattgttctactcgcgcgtgggacagcacacctcg
gttggtggctactggaacgatccgcagaggcaggatctctacctgaagtacagcgaattc
ctgccactgatcaataatgagaagaagacctccaactccacatcttttaagatgggaatg
gtgcgtctaaataagttggtaatgatcggcggacccaacgacgatgtgattactccgtgg
caatcgagccactttggttactttgacgagaatatggatgtgattccatttattaggcga
ccgattttcaccagcgactccattggcatcaggacgcttcaggaggccggcaagcttatc
attgtggtcaaaccccatgttcatcatcttgcctggcacacgcgaagggatgtcatccac
gaagtgatatttccatatctggactga

DBGET integrated database retrieval system