KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4871Help
Entry
Dmel_CG4871       CDS       T00030                                 

Gene name
ST6Gal
Definition
(RefSeq) sialyltransferase, isoform B
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00510  N-Glycan biosynthesis
dme00514  Other types of O-glycan biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    Dmel_CG4871 (ST6Gal)
   00514 Other types of O-glycan biosynthesis
    Dmel_CG4871 (ST6Gal)
Enzymes [BR:dme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     Dmel_CG4871 (ST6Gal)
Glycosyltransferases [BR:dme01003]
 Terminal extension
  Sialyltransferase
   Dmel_CG4871 (ST6Gal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29 DUF2816
Motif
Other DBs
NCBI-GeneID: 37950
NCBI-ProteinID: NP_523853
FlyBase: FBgn0035050
UniProt: Q9GU23
Position
2R
AA seq 474 aa AA seqDB search
MRQVTRASSGQSQALLSCLIIAVCAALIIQSGHIQGVKAQPGREPGEVNSRQPGNGAYEN
STGTERRLRKVIWKCIPTGNGTTGHRVPRSVFHVRWNPNEKFIVESRENPAINSSKLAPH
PRLKVSKNTKLTLSPKLYLCHDKHSELCHNKTQQFRQRIVRAFEKAMVESVNESQANHYN
VDYKPVFGDSFEEQYYPSTCLVMEAGVRVLRRKDAPFNKLPFGRLFPRQKLFRNVKDIKT
CAIVSSAGSLAGSKLGRFIDTHDIVMRFNHAPTQGHEVDVGSKTTIRVVNSQVVTKPEFD
FTRAPIFRNVTIAAWDPGKYNGTLEDWLTSADYDLFSNYELYRRRYPKSRAFLIDPHSVW
RLWQSLQMFAGNRPISKNPPSSGFIGLALLLPHCPQVDFVEYVPSTRLNGRCHYYSKEMN
SACTFGSWHPLAAEKLMALDMNMAEDDDMSVFQFGILRIRRPDKLLCGFNFFGY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaggcaagtgacacgcgcatcgtcgggtcaaagtcaggccctcctttcatgcctcatt
atcgccgtgtgcgccgcattaataattcaatctgggcatatccagggtgtgaaagctcag
ccgggacgcgaacccggcgaggtgaattcgcggcagcccggcaacggtgcgtatgaaaac
agtactggcacggagaggcgattgcgcaaagtaatttggaaatgcattcccacaggaaat
gggaccactggccaccgcgtgccgcgcagtgtgttccacgtgcgctggaaccccaacgag
aagttcatcgtggagagtcgcgagaatccggccatcaactcgtccaagctggctccgcat
ccccgactcaaggtctcgaagaacaccaagctcacgctgagccccaagctgtatctctgc
cacgacaagcactcggagctgtgccacaacaagacccagcagtttcgccagcgcattgtc
cgggccttcgagaaggccatggtggagtcggtaaacgagtcgcaggcgaaccactacaac
gtggactacaagcccgtctttggggacagcttcgaggagcagtactacccctcgacctgc
ctggtcatggaggcgggcgtgcgggtcctgcgccgcaaggacgcgcccttcaacaaactg
cccttcggccggctctttccgcgtcaaaagctcttccgcaacgtcaaagacatcaagacc
tgcgccatcgtctccagtgcgggatccttggctggctccaagttaggccgcttcattgac
acgcacgacattgtgatgagattcaatcatgcgcccacgcaaggacacgaggtggatgtt
ggcagcaaaaccacgatccgtgtggtgaattcgcaagtggtcaccaagccggaattcgac
ttcacccgagcccccatcttccggaacgtcacgatcgccgcctgggatccgggcaagtac
aatggcacactggaggattggctcactagcgctgactacgacctcttttccaactacgag
ctgtacaggcggcgctatccgaagtcacgtgccttcctcatcgatccccactccgtgtgg
cgcctgtggcagagtctgcagatgtttgccggaaaccggccgataagcaagaatcccccc
agttccggttttataggactggccctgctcctgccgcactgtccccaggtggacttcgtg
gagtacgtgccgtccacacgactcaatggacgctgtcactactacagcaaagagatgaat
tccgcctgcacattcggctcctggcatccgctggccgccgagaagctgatggccctggac
atgaacatggcggaggacgacgacatgtcggtcttccagttcggcatcctgcggattcgc
cggccggacaaactgctctgcggcttcaacttctttggctactga

DBGET integrated database retrieval system