KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4878Help
Entry
Dmel_CG4878       CDS       T00030                                 

Gene name
eIF3-S9
Definition
CG4878 gene product from transcript CG4878-RA
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dme00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dmel_CG4878 (eIF3-S9)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Dmel_CG4878 (eIF3-S9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
2R:54C3-54C3
AA seq 690 aa AA seqDB search
MAKKKSEEHSGTDANDSDYQEEPNFDDPPGFVDNISDEDLLGDMLAQRPSEADGVESVVV
VDNIPKVEPVRLEKLKLVINKLFSNYGEIVNVVYPVDEEGKTKGYAFMEYKQARQAEEAV
KKLNNHRLDKNHTFAVNLFTDFQKYENIPEKWEPPTVQTFKVQSDLYNFINDPDTYDQYC
VAAETAPNCVQVGFWQNVLPEPFELETRERFTDTFVKWSPLGTYVVTFHKPGVAIWGGSS
FQKIQKFPHPGTQFVEFSPCENYLVTYGPTPTGQKIIIWDIRTGAEKRSFVADGMSVLSM
FRWSHDDKFVARMGENSIHIYETPSFYLLDLKSIKIPGIRGFSWSPTDNVIAYWVEEQNQ
IPARVTLMEIPKKREIRNKNLFHVADCKLHWQKSGDYLCVKVDRYSKLKKDKKDLDVKFL
GMFYNFEIFHMREKEIPVDSVEIRELILAFAWEPVGNKFSIIHGETNSSNVSFYEVNKGV
KPSLVKRLEKKSCTHLFWSPRGQFIVMANLTMGTFEFVDSTNDYIITASPDHFRASEVEW
DPTGRYVVTGVSSWKVKEDTGFNMYTFQGRIIKRTILKNFVQFLWRPRPPTLLSEEKQKE
IKKNLKKYYAAFEQKDRLRLTRASKELLEKRSQLRETFMEYRNKRIAEWAEQKSRRIMLR
GHVDTDNLETDEVDEEIVEFLVKEEVTLLE
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagaaaagcgaggagcactccggtacggatgcgaacgacagtgattaccag
gaggagccgaactttgacgatccgcccgggttcgtggacaacattagtgatgaagatctg
ctgggcgacatgttggcccagcgcccctcggaggccgatggcgtcgagagtgtggtggta
gtggacaatatcccaaaggtggagccggtgcgcctggagaagctgaagttggtcatcaac
aagctgttttcgaactacggagaaatcgtcaatgtggtctatcccgtcgacgaggagggc
aagaccaagggctacgccttcatggagtacaagcaggccagacaggcggaggaagccgtc
aagaagctcaacaatcatcgcctagacaaaaaccacacctttgccgtcaatctcttcacc
gatttccaaaagtacgaaaacatccccgagaagtgggagccgccaaccgtgcagaccttc
aaagtgcagagcgatctatacaacttcatcaatgacccggacacttatgaccagtactgc
gtggcagcggagaccgctcccaactgcgtgcaggttggtttctggcaaaacgtattgccc
gaaccctttgagctggagactcgcgaacgcttcaccgacaccttcgtcaagtggtcgccc
ctgggtacttatgtagtcaccttccacaaacccggtgtggccatctggggtggcagtagc
ttccagaagattcagaagtttccccatcctggtacccaattcgttgagttttcgccctgc
gagaattacctagtgacttacggaccgacacccacgggccaaaagatcatcatctgggac
attcgcactggagccgagaaacgttcgtttgttgccgatggcatgtcggttctttctatg
ttccgctggtcgcacgacgacaagtttgtggcccgcatgggcgagaattcgatccacatc
tacgagacaccctctttctatcttctggacctgaagtccattaagattcccggcattcgt
ggcttctcttggtcccccacagacaacgtgattgcctactgggtggaggagcagaaccaa
atacccgcccgcgttaccctgatggagatccccaagaagcgtgagatccgtaacaagaac
cttttccatgtggccgattgcaagttacattggcaaaagtccggcgactatctgtgcgtt
aaggtagatcgttactcaaagttgaagaaggataagaaggacctggacgtcaagtttctg
ggcatgttctacaactttgagatcttccacatgcgcgagaaggagattcccgtcgactct
gtggagattcgtgagcttattttggcctttgcctgggagcccgtcggcaacaagttctcc
atcattcacggcgagaccaactcgtcgaatgtgagcttctacgaggtgaacaagggcgtt
aagcccagcttggtgaagcgtctagaaaagaagtcatgcacacatctgttctggtcgcca
cgcggtcagtttatcgtaatggccaacctcaccatgggtaccttcgagtttgtggactcc
accaacgattacatcatcacggcatcgcccgatcatttccgcgcttccgaggtcgagtgg
gatcccactggacgctacgttgtgactggtgtctcgtcatggaaggtgaaagaggatacc
ggcttcaacatgtacacgttccagggccgcatcatcaagcgtaccattcttaagaacttt
gtgcagttcttgtggcgcccgcgtcctcccaccctgcttagcgaggagaagcagaaggag
atcaagaagaacttgaagaagtactacgctgccttcgaacaaaaggatcgcctgcgcctt
acccgtgcctccaaggagctgctcgagaagcgctcgcagctgcgcgagacctttatggag
taccgcaacaagcgtattgccgagtgggcggagcagaagagtcgtcgcatcatgctgcga
gggcatgtggacacagacaacctggaaactgacgaagtggatgaagaaattgttgaattt
ttagtcaaggaagaagtcactctgctggagtag

DBGET integrated database retrieval system